KEGG   Sinorhizobium meliloti BL225C: SinmeB_4354Help
Entry
SinmeB_4354       CDS       T01884                                 

Definition
(GenBank) Tripartite ATP-independent periplasmic transporter DctQ component
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pSINMEB02:972387..972992
Genome map
AA seq 201 aa AA seqDB search
MNQSVAPPRYARAIVSLSEAVLAIEKRAVAGLMCVLLALILLNVATRYSGHPLYWVDESA
VYAMVWLAFLGGSALTRLRLDFAVTLLTDYLPPAAARWMRAASTLLVLLFALALAAFCWM
WMDPVGIIRAGFDAKAFAAESFNFLYTERSQTLNWPIWAISLVIPLFAVTMTVHCAANLV
EDLGLSPQRERRELSSAEGVN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagtcagtcgcgccgccgcgttacgcgcgcgccatcgtctctctctccgaagcc
gtcctcgccatcgaaaagcgcgcggttgccggattgatgtgcgtgcttctcgcgctcatc
ctcctgaacgtcgccacccgctacagcggacatccgctctattgggtcgatgaatcggcc
gtatacgctatggtctggctcgccttcctcggaggctcggcgctgacgcgtctcagactt
gacttcgctgtgacgctgctgacggattacctgccgcccgcagcggcgcgctggatgcgc
gcggcctcgactctgctcgtcctcctgttcgcgttggcgcttgcggcattctgctggatg
tggatggaccccgtcggcatcatccgcgccggcttcgacgcgaaggccttcgccgccgag
agcttcaactttctctatactgagcgcagccagacgctgaattggccgatctgggcgatc
agcctcgtcattcccctcttcgccgtaaccatgaccgtccattgcgccgccaatctcgtc
gaagacctgggcctgtcgcctcagcgtgagcggcgcgaactttcgagcgccgagggagtg
aactga

DBGET integrated database retrieval system