KEGG   Sinorhizobium meliloti BL225C: SinmeB_4356Help
Entry
SinmeB_4356       CDS       T01884                                 

Definition
(GenBank) Extracellular solute-binding protein, family 7
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pSINMEB02:974286..975281
Genome map
AA seq 331 aa AA seqDB search
MTFSRRTFLGGVAAGAALSLATPSLVRAQETRTLRLGIVTPPGHPWNNAALKVGEALKAE
TNGRLSISVFPAGQLGNEAAMLQQMQSGALDLGWIMTAELGSRIPAVAAINAPWVVDSTA
KVAKLVREPVAMKLLDVLPAETGTVGLAWGITTMRVVFSAKEIAGLDDINGMKLRINTTP
AYRDFYQLLGAAPTPIPTPAVFDAMSNGQVDGLEADLDFSWNQRFDKVSKTMLKMNAIFM
PCVALASGRVWQTLPEADREIIGRLTKSALDEQIDATVANEPALLEKFAGAGIPIKDVTV
ADAGRIIAEYDKIWLPKAPVLAELRKVGATL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgacattctcccgcagaaccttccttggcggcgttgccgccggcgcagccctctcgctc
gccacgccatcgctcgtgcgcgcgcaggaaacgcgcaccctgcgcctcggcatcgtcacg
ccgccgggacacccctggaacaatgccgcactcaaggtgggcgaagccctcaaggccgag
acgaacggccgcctgtcgatctcggtctttccggccggccagctcggcaacgaggcggcg
atgctgcagcagatgcagagcggcgcgctcgatctcggctggatcatgaccgccgaactc
ggctcgcgcattcccgccgttgccgcgatcaacgcgccctgggtcgtcgattccaccgcc
aaggtcgccaagctcgtgcgcgaaccggtcgccatgaagctcctcgacgttcttccggcc
gagaccggaacggtcggccttgcctggggcatcaccaccatgcgcgtcgtcttctcggcc
aaggagatcgccgggctcgacgacatcaacggcatgaagctgcgcatcaatacgacgccc
gcctatcgcgatttctaccagctcctcggcgccgcgccgacgccgattccgacgccggcc
gttttcgacgccatgtcgaacggccaggtggacggtctggaggcggacctcgacttctcc
tggaaccagcgcttcgacaaggtttccaagaccatgctgaagatgaacgccatcttcatg
ccctgcgtggcgctggcctccggccgcgtatggcagacccttcccgaggccgaccgggag
atcatcggccgcctcaccaagtcagcgctcgacgagcagatcgacgcaaccgtcgccaac
gagccggccctcctcgaaaagttcgccggcgcaggcattccgatcaaggatgtcacagtc
gccgacgccggccggatcatcgccgaatacgacaagatctggctgccgaaggcaccggtt
ctcgccgaacttcgcaaggtcggcgcaacgctctga

DBGET integrated database retrieval system