KEGG   Sinorhizobium meliloti BL225C: SinmeB_4363Help
Entry
SinmeB_4363       CDS       T01884                                 

Definition
(GenBank) dihydroxyacetone kinase, L subunit
  KO
K05879  phosphoenolpyruvate---glycerone phosphotransferase subunit DhaL [EC:2.7.1.121]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00561  Glycerolipid metabolism
smq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SinmeB_4363
Enzymes [BR:smq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.121  phosphoenolpyruvate---glycerone phosphotransferase
     SinmeB_4363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak2 Gp68
Motif
Other DBs
NCBI-ProteinID: AEG08645
JGI: SinmeB_4363
UniProt: A0A0E0UQP4
Position
pSINMEB02:982854..983495
Genome map
AA seq 213 aa AA seqDB search
MQTFENARAGDIVLTLADRIIENRAYLSEIDGKIGDGDHGVNMAKGFGLAAERLKGKDAS
LAEALDTLGTVLMTEIGGSMGPLYGVMFTEFAQKIEGADAIDAAAYSRMLHAGLEGIRSI
GSAKVGDKTLLDTLVPAVDAFDAATADGRPFAEALDALVSAAEAGRDSTRDLIARIGRAS
RLGERSLGVLDAGATSCAIILRELSHGARARLA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgtttgaaaatgcaagagccggcgacatcgtcctcacgcttgccgaccggatc
atcgaaaaccgcgcctatctgagcgagatcgacggcaagatcggcgatggcgatcacggc
gtgaacatggccaagggctttggccttgccgcagaacgcctgaagggcaaggacgcctcg
cttgcagaggcgctcgatacgctcggcaccgtgctgatgacggagatcgggggctcgatg
gggccgctctacggcgtgatgttcaccgaattcgcgcaaaagatcgagggcgctgatgca
atcgacgccgccgcctatagccgcatgcttcatgcggggctcgaaggcatccggtcgatc
ggctccgccaaggtgggcgacaagacgctgctcgacaccttggtgcctgcggtcgacgcc
ttcgatgcggcgactgccgacggcaggcccttcgccgaagcgctcgacgcacttgtatcg
gcggcggaggccggccgcgactcgacgcgcgacctcatcgcgaggatcggccgggcgagc
cgcctcggcgaacgctcgctcggcgtgttggacgccggcgccacctcctgtgcgatcatc
ctcagggagttgtcccacggggcacgcgcccggctcgcctga

DBGET integrated database retrieval system