KEGG   Sinorhizobium meliloti BL225C: SinmeB_4384Help
Entry
SinmeB_4384       CDS       T01884                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_28 HTH_23
Motif
Other DBs
NCBI-ProteinID: AEG08666
JGI: SinmeB_4384
UniProt: A0A0E0UPV6
Position
pSINMEB02:1006441..1007418
Genome map
AA seq 325 aa AA seqDB search
MIVMEIRELEAFLAVMSTGSITAAARLLDRSQSQVTRLIQDLEISVGFALFDRNGPKIAP
SEKGIAFHAEAERFLSGIGHLRERARTIAEKEPQPIEIVAIPAFASGIIPLALAALPEKL
LPRKIHLRSLPAEAAVQSVLARTADFCVTSLPADQPGLEVHGVFQGPCVAAVAEDDPLAA
CEVISIADLAGRNIITMANPFRLRRRVDIALEAANIRPARIIATSVSVNAVQIASTGLGV
AIVEPATAYGLKLANVAVRPLDVDIPFPWAIFSAAARPLSDSSRELIQAIIQIASACIPG
FTAHDPRNANRAAEMNLGGDQADAR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcatggagatacgggaactcgaggcctttcttgcggtgatgtccaccggcagc
atcaccgccgccgcccggctgctcgatcgctcccagtcccaggtcacgcgcctcatccag
gacctggaaatttccgtcggcttcgcgctcttcgaccgcaacggtccgaagatcgcaccg
agcgaaaaggggatcgcattccatgcggaagccgagcggttcctgagcggcatcggccat
ttgcgggagcgggcaaggacgatcgcggaaaaggagccccagccgatcgagatcgtagcg
atcccggctttcgccagcggcatcatccccttggcgctcgcggcgttgccggaaaagctg
ctgccgcgaaaaatccatctgcgcagcctgccggcagaggcggcggtgcaatcggtattg
gcccgcacggcagatttctgcgtcacgtctctgccggccgaccagccgggactggaagtg
cacggggtgtttcagggaccttgcgttgccgccgtggcggaagatgatcctcttgccgcc
tgcgaagtgatttcgatcgccgatcttgccggacgcaacatcatcacgatggccaatccg
ttccgcctgcgccgccgcgtggacatagcgttggaagccgcgaatatccgcccggccagg
atcatcgcgaccagcgtttcggtcaatgcggtacagatcgcatcgacggggctcggcgtc
gcaatcgtcgagcctgcgacagcctacggcttgaagctggccaatgtcgcggttcgcccg
ctcgacgtcgacattcccttcccgtgggcgatcttttcggccgccgcgcgtccgttgtca
gacagctcacgcgaactgatccaggcgatcatccagatcgcttccgcctgcatcccggga
tttaccgctcacgacccgcgcaacgccaatcgcgccgctgaaatgaacttgggaggagac
caggccgacgcacgctag

DBGET integrated database retrieval system