KEGG   Sinorhizobium meliloti BL225C: SinmeB_4387Help
Entry
SinmeB_4387       CDS       T01884                                 

Definition
(GenBank) ABC-type transporter, integral membrane subunit
  KO
K11070  spermidine/putrescine transport system permease protein
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq02010  ABC transporters
Module
smq_M00299  Spermidine/putrescine transport system
Brite
KEGG Orthology (KO) [BR:smq00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SinmeB_4387
Transporters [BR:smq02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Spermidine/putrescine transporter [MD:M00299] [OT]
    SinmeB_4387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AEG08669
JGI: SinmeB_4387
UniProt: A0A0E0UQ02
Position
pSINMEB02:1009675..1010466
Genome map
AA seq 263 aa AA seqDB search
MRPYFADLPKTALGAAYWLFAVYLLLPLALMTAMSFKDASFVAFPITDWTLNWYAQVLND
KQFIEASLYSIGIALATTAAATVIGVWIALLVSTEGIWGKAIIFALACLPAVVPGLINAI
SMRIFIRTVDIPTGTAAIILSHAVHAVPFVVIMVLTRLRSMPANLVDAARDLGADRFVAF
LRVTIPYLMPALLGGMIFCVLTSIDDFVRTFFLGGYKPTLPMLIFAKVQGGMSPEINAMA
TIVLVVTAAVGVYAEHLTRRSRN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccatacttcgccgacctaccgaaaaccgccctcggtgccgcctactggctgttt
gcggtctatctcctgttgccgctggcgctgatgacggccatgagcttcaaggatgcgagc
ttcgtcgcctttccgatcacggactggacgctcaactggtatgcccaggtgctcaacgac
aagcagttcatcgaagcctcgctctattcgatcgggatcgcgctggcgaccaccgcggcg
gcgacggtcataggcgtctggattgcgcttctggtctcgaccgaaggcatctggggcaag
gcgatcatcttcgcactcgcctgcctgccggcagtcgttccgggcctcatcaacgcaatc
tccatgcggatcttcatccgcaccgtcgacatcccgaccggcacggcggcgatcatcctg
tcgcatgcagtccatgcggtgcccttcgtggtgatcatggtgctcacgcgcctacgctcc
atgccggccaatctggtcgacgcggctcgcgatctcggcgccgatcggttcgtggccttc
ctcagggtcacgatcccgtacctgatgccggcactcctcggcggcatgatcttctgcgta
ctcaccagtatcgacgacttcgtccgcaccttcttcctcggcggctacaagcccacgctc
ccgatgctgatcttcgcgaaggtgcagggcggcatgtcgccggaaatcaacgccatggcg
acgatcgtgctggtcgtgacagccgctgtcggcgtttacgccgagcacctcacccgccgt
tcaaggaactga

DBGET integrated database retrieval system