KEGG   Sinorhizobium meliloti BL225C: SinmeB_4647Help
Entry
SinmeB_4647       CDS       T01884                                 

Definition
Dihydrolipoyllysine-residue succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SinmeB_4647
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SinmeB_4647
  Amino acid metabolism
   00310 Lysine degradation
    SinmeB_4647
Enzymes [BR:smq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SinmeB_4647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pSINMEB02:1273924..1275060
Genome map
AA seq 378 aa AA seqDB search
MGGLIDIQAPLEQEGTKAVVRNWLRKIGDPVKSGDPLVELETDKVTQEVSAPADGVLAEI
LMRNGDDATPGAVLGRIGSEAAGAGHAPHYSPAVRHAAEEYGLDPATVTGTGRGGRVTRA
DMDRAFTARQEGPASVAAEAGDRGAAPKSRRIPHSGMRAAIAEHMLNSVTTAPHVTAVFE
ADFSAVMRHRDEHGKRLAADGTKLSYTAYVVSACVAAMRAVPEVNSRWHEDALETFDDIN
IGVGISLGDKGLVVPVIHRAQDLSLAEIAARLQDLTTRARSNALSRADVTGGTFTISNHG
ASGSLLAAPIIINQPQSAILGVGKLDKRVIVREVDGADTIQIRPMAYVSLTMDHRALDGH
QTNAWLTHFVRVIETWPK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcctcatcgacatccaggctccgctggagcaggaggggaccaaagcggtcgtc
cgcaattggctcaggaagatcggcgatccggtcaaatcgggcgatcccctggtcgagctc
gagaccgacaaggtgacccaggaggtgtcggcgcccgccgacggggtgctcgcggaaatc
ctgatgcggaatggcgacgatgccacgcccggcgccgttctcggccggatcggcagcgag
gctgccggggcgggacacgcgccgcactactcgccggccgtacggcatgccgcggaagaa
tatggcctcgatccggccaccgtcaccggcaccggccgcggtggccgcgtcacgcgcgcc
gacatggacagggcgtttaccgcccggcaggaaggccctgcttcggtcgcggccgaggct
ggcgacagaggagccgcacccaagtcgcgcaggataccgcatagcggcatgcgcgccgcg
atcgccgaacatatgctcaactccgtcacgacggcgccgcatgtgacggccgtgttcgag
gccgatttctcggcggtgatgcgccatcgcgacgagcatgggaagaggcttgcggcggac
ggcaccaagctctcctatacggcctatgtggtttcagcctgcgtggcggcgatgcgcgcg
gtccccgaggtcaacagccgctggcacgaggatgcgctcgaaacattcgacgacatcaat
atcggcgtaggtatttccctcggggacaagggcctggtcgtgccggtgatccatcgggcg
caggatttgtcgcttgccgagattgcggcccggctgcaggacctgacgacgcgtgcgcgc
tcgaacgcgctctcccgcgcggacgtgacgggcggcaccttcaccatttccaatcatgga
gcctccggatcgctgctcgcggcgccgatcatcatcaaccagccgcaatcggcgatcctc
ggcgttggcaagctcgacaagcgggtgatcgtccgcgaggtggacggcgccgacacgatc
cagatccgtccgatggcctatgtgtcgctgacgatggaccatcgtgcgctggacggccac
cagacgaatgcgtggctgacgcatttcgtccgcgtgatcgagacctggccgaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system