KEGG   Sinorhizobium meliloti BL225C: SinmeB_5760Help
Entry
SinmeB_5760       CDS       T01884                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SinmeB_5760
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SinmeB_5760
  Lipid metabolism
   00071 Fatty acid degradation
    SinmeB_5760
  Amino acid metabolism
   00350 Tyrosine metabolism
    SinmeB_5760
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SinmeB_5760
   00626 Naphthalene degradation
    SinmeB_5760
Enzymes [BR:smq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SinmeB_5760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pSINMEB01:679861..680889
Genome map
AA seq 342 aa AA seqDB search
MAQTMKAAVVRQFRAPLTIEEMEVPTPGAGQVLVKYEATGVCHTDLHAANGDWPVKPAPP
FIPGHEGVGFVSAVGAGVRRVKEGDKVGVPWLHTACGYCTYCRTGWETLCASQSNTGYSV
NGTFAEFGLADPEFVGKIPDGLEFGAAAPVLCAGVTVYKGLKETEVRPGEWVAISGVGGL
GHMAVQYAKAMGMHVVAADIFEDKLALAKQLGADIAINGKSEDAIEQVKKATSGGVHGVL
VTAVSPAAMEQAFGFLRSKGTMVLVGLPPGMMSLPVFETVLKRITVRGSIVGTRQDLEES
LVFAAEGKVKPYFSWESLENINDIFHRMEAGKIDGRIVVRLQ
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcacagacaatgaaggcggctgtcgtacgccagttccgcgctccgctgaccatagag
gagatggaagtcccaacgcctggcgcggggcaggtcctggtaaaatatgaagcgacgggc
gtgtgccataccgatttgcatgcggcaaacggcgattggcccgttaagccggccccgccc
tttattccagggcatgagggtgttggcttcgtctcagccgtgggcgccggcgtgaggaga
gtgaaagaaggtgacaaggttggggtgccatggctccacaccgcttgcggttactgtacc
tattgccggaccggttgggaaacgctgtgcgcttcgcaatcgaacaccgggtactcagtg
aacggcaccttcgcggagttcggactggcagatcccgagttcgtcggaaagattcctgat
gggttggaattcggagccgccgcgcccgttctctgcgcgggagtgaccgtctacaagggg
ctgaaggaaacggaagtccgtcccggtgaatgggtggccatctcgggcgtcgggggtctc
ggccacatggcggtgcaatatgccaaggcaatgggaatgcacgtagtggccgccgacata
ttcgaagacaagctggcgctggctaagcaacttggcgccgacatcgcaataaacggcaag
tcagaagatgcaatcgagcaggtaaagaaggccacgagcggcggcgttcacggagtgctc
gtgaccgctgtctctcccgccgccatggaacaggcctttggtttcctgcgatcgaaaggt
acgatggtcttggtcggccttccccccggaatgatgtccttgccggttttcgagaccgtc
ctgaaacgcataaccgtgcgtggatcaatcgtgggcacccgtcaagatcttgaggaatcg
ctcgtgttcgcggcggaaggcaaggtaaagccttatttctcgtgggagagcctcgagaac
atcaacgacatctttcatcgcatggaagcgggcaagatcgacggtcgcatagtcgtgcga
ttgcaatag

DBGET integrated database retrieval system