KEGG   Sinorhizobium meliloti BL225C: SinmeB_5936Help
Entry
SinmeB_5936       CDS       T01884                                 

Definition
glucan 1,3-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SinmeB_5936
Enzymes [BR:smq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     SinmeB_5936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pSINMEB01:complement(856744..858186)
Genome map
AA seq 480 aa AA seqDB search
MTVAFRSKPVTVEDPAYRGLAIGAYAPAVTPAPAFAQTDLAALSRYYSLLMMRNITSDGY
VIEDPASPGVFSVPGCVIAAPSYPANTPGVDQDYVFNWVRDGAMTAIEIALADLPRVPGG
GVPSLIDYVNFAALCQADAKNSATATLGHACFTITGKVRPWSEQNDGPAIQSIAILTLFD
QLDGATQKIAKRLVETNLSYLLEVYQNKTTNLWEEYEGYSFFARAVQLRFFREISRNTIG
IAVPAGVADAISWLQNQLADHWNGQLYVSVLDVAAQAGYDANIDIVSSVCYGGIDPADTK
LLATAAILRRQWADISSSSYFPINGADATKGLGPAFGRYPGDHYDGDVAAPVVGGHPWAL
CTANFAEFQYRLANAIDASGAIPLDQFSEPFFAELGLGASSSAAGASTALRASSDAMLRA
IVYHSDHYELSEQFDGTTGYEKSVRNLTWSYASFLSAVRARSGGIPAAKNKPRNSRSRRS
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgcatttcgcagtaagccagtgacagttgaggacccggcatatagaggcctg
gcaattggcgcttatgcgcctgcagtcacaccggcgccggcctttgcgcagaccgatctg
gctgcattgtcgcgctactattctcttctaatgatgcgcaacatcaccagcgacggctac
gtcatcgaggatccagcatcgcccggcgtcttttcggtaccgggctgtgttatcgccgca
ccttcctatccagcgaacacgccgggtgtcgaccaggactatgttttcaactgggtccgc
gacggagctatgacggccatcgagatcgcgcttgccgacttgccgcgcgttccgggcggg
ggtgtgccgagcctgatcgactacgtgaacttcgccgcgctgtgtcaggcggatgcgaag
aattccgcgaccgccacacttggccatgcctgcttcaccatcaccggcaaggttcgtccg
tggtcggagcaaaatgacgggccggccattcagtcgatcgccatcctgaccttgttcgat
cagctggatggtgccacgcagaaaatcgctaaacgattggttgagactaacctctcttat
cttctcgaagtttaccagaacaagaccacaaatctctgggaggagtatgagggctattcc
tttttcgcaagagccgtacagctgcgctttttccgggagatttccagaaacacgatcggt
attgcggtgcctgccggggtggccgatgccatctcctggctgcaaaaccagctggccgac
cactggaatgggcagctctatgtgagcgttctggatgtcgcggcgcaagccggttatgac
gcgaacatcgatatcgtctcttcggtctgctatggcgggatcgatccggctgacaccaag
ctcctggcaacggcggcaatcctgcggcgccagtgggctgatatttcgtcttcgagctat
ttcccaatcaatggcgccgacgcgacaaaagggctcggacccgccttcgggcgctatccg
ggcgaccattacgatggggatgtggcggctccggtggtcggcgggcatccctgggctctg
tgcaccgccaacttcgccgagtttcaatatcggcttgccaatgccatagacgccagcggc
gccattcctctcgaccagttctccgaacccttcttcgctgaattagggcttggcgcatcc
agcagcgccgccggcgcgtcaactgccttacgggcttcgtctgacgccatgctgcgcgcc
atcgtctaccacagcgatcactatgaactgagcgagcagttcgatggaaccactggctat
gagaaaagcgtccggaacctgacctggagctacgcctcttttctctcggcagtcagagcc
cgctccggcggtatcccagccgctaagaacaaaccccgaaactcccgcagccgacgatcg
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system