KEGG   Sinorhizobium meliloti BL225C: SinmeB_6323Help
Entry
SinmeB_6323       CDS       T01884                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SinmeB_6323
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SinmeB_6323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pSINMEB01:complement(1233413..1233781)
Genome map
AA seq 122 aa AA seqDB search
MNKVVIAALVSLAVSGHATPALSQEAAPGQKLFQQRCGACHQLETPRNGVGPHLLGVVGR
TAGSVDGFRYSAALKGSGIAWTAETLETFLSNPAAMVRGTRMAQRFNNADERRAIIAFLG
AQ
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaaggtcgtcattgctgcgctcgtttctcttgctgtttcaggccacgccacgccg
gctctgtctcaggaggctgcaccaggtcagaagctgtttcagcaacgctgcggtgcgtgc
catcagctcgagacacctcgaaacggcgtcggaccgcatctgctgggtgtcgtcggccga
acggccgggagcgttgacggcttcaggtattccgcggcgcttaaaggttccggtatcgca
tggaccgccgaaacgctggaaaccttcctgagcaatcccgccgcgatggttcgcggaacg
cgcatggcccagcgtttcaacaacgccgacgagcgtcgagcgatcatcgcgttccttggg
gcgcaatag

DBGET integrated database retrieval system