KEGG   Staphylothermus marinus: Smar_0007Help
Entry
Smar_0007         CDS       T00485                                 

Definition
6-phosphofructokinase (EC:2.7.1.11 2.7.1.73 2.7.1.-)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
smr  Staphylothermus marinus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:smr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Smar_0007
Enzymes [BR:smr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Smar_0007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3934..4863)
Genome map
AA seq 309 aa AA seqDB search
MNVEKYDVVAVGHGLVDIRFIVDRFVGPDEEASIIKQTRGVGGSAANVSIDVSRLGGRSA
VIVKVGLDGFGRLVIDELMREKVDVSGVKVCLGDTGFTVVIIDRDGKIIMYGYKGSAEKL
EPKDLDEGIISRGKYLHIASLRLDTSLEAAKLAKKHGLKTAWDPGRRLSLKGLSYFDELL
KYIDIVLVNKKEAYHLTGISDYREAAKKILETGVWLVVIKRGPEGIYAVTSDGETYDLPA
FPVDKVIDTTGAGDAFASGLLLGLSRGYNLKKALIYGNAVAALKTSRLGSHNVPSHEEVI
KYIWEHGLS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtggagaagtatgatgtagttgctgttggccatggattggttgatataagattt
attgttgataggtttgttggccccgatgaagaggctagtattattaagcaaacgcgtggt
gtaggtggatcggctgcgaatgtttctattgatgtatcaagactaggcggcagatcagct
gttatcgttaaggttggattagatgggtttggcaggcttgttattgatgagcttatgcgt
gagaaagtagatgtttcaggtgtaaaggtttgccttggagatacaggtttcacagttgtg
atcattgatagggatggaaaaataataatgtatggatacaagggttcagctgagaaactt
gaacctaaagatcttgatgaaggaattatttctcgtggcaaatatttacatattgcaagt
ttaagactagatacttcactggaagcagctaaattggcgaagaagcatggtttaaaaact
gcttgggatcctggtaggcgtttatctctgaaggggttaagctactttgatgaattattg
aagtatatcgatatagtattagttaataagaaggaagcttatcatttaacaggtattagt
gattatagggaagccgctaagaaaatactggaaactggagtatggctcgtagtaattaag
cggggacccgagggtatatatgctgttacaagtgatggtgaaacatatgatctccctgct
ttcccagtagataaggttatagatacaactggtgctggagacgcattcgcttccggatta
ttgttaggtttgagtagagggtataatttgaagaaagcattaatatatggaaacgctgta
gcagcattgaaaaccagtcgtttaggaagtcataatgtgcctagccatgaagaagtaata
aagtatatttgggaacatggattatcctag

DBGET integrated database retrieval system