KEGG   Staphylothermus marinus: Smar_0045Help
Entry
Smar_0045         CDS       T00485                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
smr  Staphylothermus marinus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Smar_0045
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smar_0045
  Lipid metabolism
   00071 Fatty acid degradation
    Smar_0045
  Amino acid metabolism
   00350 Tyrosine metabolism
    Smar_0045
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Smar_0045
   00626 Naphthalene degradation
    Smar_0045
Enzymes [BR:smr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Smar_0045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
38711..39874
Genome map
AA seq 387 aa AA seqDB search
MKMPSFQVYNGGVKLFFGINVIGNAEEFIKAYKRILLVTGRRSAKISGALDDVTSILDKH
GIEYTVYNDIVPNPIVENVEGIVKAYKEFGAEAIIAIGGGSIIDSAKVARLVISGGGSVV
DYLYGRKPYPEKLPFLLAINLTHGTGTEIDKYAVVSIVETKEKIGISAGYPNVSIDDPRY
TRTLPRNQTIYTSIDAFAHSVESATSTRSSPYTWLLAEEAIKHIVKHLPRALEKPDDLEA
RYWLLYASMIAGISIDHGVTHIGHGLEHVFSGFNPKLPHGAGLAILYKALLQFFYKLDPE
VMARILKPLDPELKPRVEDAEKAQKAYNKFLEEIGFNESFSTYGFSIEDVKEAVKFYYEN
EKMKRYHGLAPKLPSREDLEKWLTSLI
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgccgtcttttcaagtctacaatgggggagttaaattattctttggcataaac
gttattggtaatgctgaggaattcattaaagcttataaaagaatattgttagttacaggt
cgtagatcagcaaagatttccggcgcacttgacgatgtaaccagtattttggataagcat
ggaatagaatataccgtatacaatgatatagtgcccaaccctatagtggagaatgttgag
gggattgtgaaggcttataaagaatttggagctgaggctattattgctataggtggtggt
agcattattgattctgcaaaagttgctaggctagttattagtggtggtggtagcgttgtt
gattatttatatggtagaaaaccgtatcctgagaaactaccgtttctcctcgcaattaat
ctaactcatggtactggtacagagattgataaatatgctgttgtaagcattgtggagacc
aaggaaaaaatagggataagtgctggttatcctaacgtatcaattgatgatccaagatat
acgaggactcttccaagaaaccaaacaatatatacatctatagatgcgtttgcacattct
gttgaatcagcaacatctacacggtccagcccatatacatggttgcttgctgaagaagcg
attaagcatatagtgaagcatcttcccagagcactggagaaaccagatgatctagaagca
cggtattggcttctatacgcatcaatgattgctggaataagcattgatcacggagtaacc
catataggacatggattagagcatgtatttagcgggttcaatcctaaactgccccatgga
gcaggactagctatattatataaagcattattacagttcttctataaattagatcccgaa
gtaatggctagaatactaaaaccattagatccagagttaaagcctagagtagaagacgct
gaaaaagcacagaaagcatataataagttcctcgaagagataggatttaatgagtcattc
tctacgtatggattcagcatcgaagacgttaaggaagcagtaaagttctattatgaaaac
gagaaaatgaagaggtatcatggattagcgcctaaattaccgagtcgtgaagatttagag
aaatggttaacttccctaatatga

DBGET integrated database retrieval system