KEGG   Staphylothermus marinus: Smar_0057Help
Entry
Smar_0057         CDS       T00485                                 

Definition
(GenBank) peptidase M42 family protein (EC:3.2.1.4)
Organism
smr  Staphylothermus marinus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(50784..51878)
Genome map
AA seq 364 aa AA seqDB search
MNKNEIYETLEKLTNIVSPSGHEDEIRNTIIELLKPYADEIWVDSLGNVIAVKKGSGEGR
LMIAAHMDEIGLMINHITKTGFLKFTPIGGWNPVILPGQRVLIKTKRREYVRGVIGMKPP
HIMKPEEAKQAPQIEDLFIDIGASSREEAEKLGITVGSVAVIERNIAKLSENVVTGRAFD
DKIGVAVMIEAFKNLEKPKVDVYAVATVMEEVGLKGARVAAYSITPHVGLALDVTIAADI
PGVDESKQITKLGKGPAIKVMDGRSGSGLIAHPAIKDTLIQLAEKHNIPYQLEVLTGGTT
DATIIQLTKEGVPTGALSVPTRYIHSPVEVLNLEDALNTAKLTKLFAEYIDMEWINKYLK
RKIK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaatgaaatatatgaaacacttgaaaagctcaccaatatagtttctccctct
ggtcatgaagatgaaattagaaatactataatagaattgcttaaaccatacgctgatgag
atatgggttgattcactaggaaacgtgatcgctgttaaaaaggggagtggtgaaggcagg
ttaatgattgctgctcacatggacgagatcggtttaatgataaatcacataacaaagact
ggattcctcaaatttacaccaataggtgggtggaacccagttatattgccgggacaaaga
gttcttataaaaactaaaagaagagaatatgttcgcggagtaataggtatgaagcctccc
catattatgaagccggaggaggctaaacaagctccacaaatagaggacttattcatagat
ataggtgcttctagtagggaggaagcagagaaactaggtataactgttggatcagtagct
gttattgagagaaatatcgcgaagctttcagaaaatgttgtaactggtagagcatttgat
gacaaaatcggtgtagcggttatgattgaagcattcaagaaccttgaaaaacccaaagta
gacgtatacgctgtagcaactgttatggaggaagttggattaaaaggagctagagtagca
gcatattctataacaccacacgttggattagcactagatgtaaccatagcagcagatata
cctggagttgatgaatcaaaacaaataaccaagctaggaaaaggccctgctatcaaagtt
atggatggaagatctggttcgggattaatagctcacccagcaatcaaagatacccttata
caattagctgaaaaacacaatattccgtatcaattggaagtattaactggtggaacaact
gatgcaacaataatacagttaacaaaggagggggtcccaacaggcgcattatctgttccg
acaagatatattcattcaccagtagaagtattgaatctagaagatgcattaaatactgcg
aagctaacaaaactattcgctgaatacatagacatggaatggatcaataaatatttgaag
agaaaaataaagtaa

DBGET integrated database retrieval system