KEGG   Staphylothermus marinus: Smar_0057Help
Entry
Smar_0057         CDS       T00485                                 

Definition
peptidase M42 family protein (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
smr  Staphylothermus marinus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Smar_0057
Enzymes [BR:smr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Smar_0057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(50784..51878)
Genome map
AA seq 364 aa AA seqDB search
MNKNEIYETLEKLTNIVSPSGHEDEIRNTIIELLKPYADEIWVDSLGNVIAVKKGSGEGR
LMIAAHMDEIGLMINHITKTGFLKFTPIGGWNPVILPGQRVLIKTKRREYVRGVIGMKPP
HIMKPEEAKQAPQIEDLFIDIGASSREEAEKLGITVGSVAVIERNIAKLSENVVTGRAFD
DKIGVAVMIEAFKNLEKPKVDVYAVATVMEEVGLKGARVAAYSITPHVGLALDVTIAADI
PGVDESKQITKLGKGPAIKVMDGRSGSGLIAHPAIKDTLIQLAEKHNIPYQLEVLTGGTT
DATIIQLTKEGVPTGALSVPTRYIHSPVEVLNLEDALNTAKLTKLFAEYIDMEWINKYLK
RKIK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaatgaaatatatgaaacacttgaaaagctcaccaatatagtttctccctct
ggtcatgaagatgaaattagaaatactataatagaattgcttaaaccatacgctgatgag
atatgggttgattcactaggaaacgtgatcgctgttaaaaaggggagtggtgaaggcagg
ttaatgattgctgctcacatggacgagatcggtttaatgataaatcacataacaaagact
ggattcctcaaatttacaccaataggtgggtggaacccagttatattgccgggacaaaga
gttcttataaaaactaaaagaagagaatatgttcgcggagtaataggtatgaagcctccc
catattatgaagccggaggaggctaaacaagctccacaaatagaggacttattcatagat
ataggtgcttctagtagggaggaagcagagaaactaggtataactgttggatcagtagct
gttattgagagaaatatcgcgaagctttcagaaaatgttgtaactggtagagcatttgat
gacaaaatcggtgtagcggttatgattgaagcattcaagaaccttgaaaaacccaaagta
gacgtatacgctgtagcaactgttatggaggaagttggattaaaaggagctagagtagca
gcatattctataacaccacacgttggattagcactagatgtaaccatagcagcagatata
cctggagttgatgaatcaaaacaaataaccaagctaggaaaaggccctgctatcaaagtt
atggatggaagatctggttcgggattaatagctcacccagcaatcaaagatacccttata
caattagctgaaaaacacaatattccgtatcaattggaagtattaactggtggaacaact
gatgcaacaataatacagttaacaaaggagggggtcccaacaggcgcattatctgttccg
acaagatatattcattcaccagtagaagtattgaatctagaagatgcattaaatactgcg
aagctaacaaaactattcgctgaatacatagacatggaatggatcaataaatatttgaag
agaaaaataaagtaa

DBGET integrated database retrieval system