KEGG   Staphylothermus marinus: Smar_0094Help
Entry
Smar_0094         CDS       T00485                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
smr  Staphylothermus marinus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:smr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:smr00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:smr00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
90597..91868
Genome map
AA seq 423 aa AA seqDB search
MFVKELKCSKCGRTYSLKEKPVMCINKDLGRLDIFYDYEAIKNAVKPEDLAKREFYMWRY
KEFLPVPDEKYIVSIGEGGTPLIKANRLAEKLGLKNLYLKDETRNPTGSFKDRCMSVSVS
MAKYFGFKRAVVASSGNAAAALAAYGARAGIEVYAFVPDFAGYGKIAQLLFYGAKVFRVR
WVEAEDPTVKMMRLLAEKYGFYPSPSFGPFNPYQIEGPKTIAMEIVEQLGWDVPDQVFVP
TGAASLLTGVYNGFRDWNNVGWINKYPRMVAVQPEGNHPFVRAWMEKADPNKIKPWEKPP
ETIATGLEDTFPWDGDAGLRALYNTNGYGVVVSDEEILEAMKLLASLEGLFAEPSGAAGL
AGLIKALEDGKVDRDETIVVLVTGHGLKDPDIVKKTAGDAPTINPDPQEFFAKAKEFYKV
DFN
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttaaggaacttaaatgtagtaagtgtggaagaacatatagtttaaaggagaag
ccagtgatgtgtataaataaggatctagggagactcgatatattctatgactatgaagca
ataaagaatgctgtcaaaccggaggatctagcgaaaagagaattctacatgtggagatat
aaggagttcttgccggtacctgatgagaaatatattgttagcataggcgagggtggaacg
cctctaataaaagctaatagactagccgagaagcttgggttaaagaatttatatttgaaa
gatgaaacacgcaaccctactggtagcttcaaggatagatgcatgagtgtttcggtatct
atggctaagtatttcgggtttaagagagcggtggtggctagtagtggtaacgctgcagct
gcgttggctgcttatggtgctagagcaggtattgaagtatatgcttttgtccctgacttc
gcaggatacggtaagatcgctcaattattgttctatggtgcaaaagttttcagagttaga
tgggttgaagcagaggatccaactgttaaaatgatgaggttattagcggagaaatatggt
ttctatccatcaccgagtttcggaccatttaatccataccagattgaaggcccgaaaact
atagctatggagatcgttgagcaacttggatgggatgttcctgaccaagtattcgtacca
acaggtgctgcaagcttgttgacaggggtctataatggttttcgtgattggaacaatgtt
ggatggataaataagtatccgagaatggttgctgtacagcctgagggtaatcatccattt
gttagagcatggatggaaaaagcagaccccaataagataaagccttgggagaagcctcca
gaaacaattgctacaggtctcgaagacacttttccatgggatggagatgcagggctaaga
gcactatataatactaatggttacggagtagtagtcagtgatgaagaaatactggaggct
atgaagcttttagccagcttagaaggattgttcgctgaacccagtggtgcagcaggtctt
gcaggattaattaaagcattagaggatggaaaagtagatagagatgaaacaatagttgtg
cttgtaacaggtcatggcctaaaggatccagatattgttaagaagacggctggagatgca
ccaactataaatcccgaccctcaagaattcttcgctaaagctaaagagttctacaaagtt
gatttcaactag

DBGET integrated database retrieval system