KEGG   Staphylothermus marinus: Smar_0094Help
Entry
Smar_0094         CDS       T00485                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
smr  Staphylothermus marinus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Smar_0094
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Smar_0094
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Smar_0094
Enzymes [BR:smr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Smar_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
90597..91868
Genome map
AA seq 423 aa AA seqDB search
MFVKELKCSKCGRTYSLKEKPVMCINKDLGRLDIFYDYEAIKNAVKPEDLAKREFYMWRY
KEFLPVPDEKYIVSIGEGGTPLIKANRLAEKLGLKNLYLKDETRNPTGSFKDRCMSVSVS
MAKYFGFKRAVVASSGNAAAALAAYGARAGIEVYAFVPDFAGYGKIAQLLFYGAKVFRVR
WVEAEDPTVKMMRLLAEKYGFYPSPSFGPFNPYQIEGPKTIAMEIVEQLGWDVPDQVFVP
TGAASLLTGVYNGFRDWNNVGWINKYPRMVAVQPEGNHPFVRAWMEKADPNKIKPWEKPP
ETIATGLEDTFPWDGDAGLRALYNTNGYGVVVSDEEILEAMKLLASLEGLFAEPSGAAGL
AGLIKALEDGKVDRDETIVVLVTGHGLKDPDIVKKTAGDAPTINPDPQEFFAKAKEFYKV
DFN
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttaaggaacttaaatgtagtaagtgtggaagaacatatagtttaaaggagaag
ccagtgatgtgtataaataaggatctagggagactcgatatattctatgactatgaagca
ataaagaatgctgtcaaaccggaggatctagcgaaaagagaattctacatgtggagatat
aaggagttcttgccggtacctgatgagaaatatattgttagcataggcgagggtggaacg
cctctaataaaagctaatagactagccgagaagcttgggttaaagaatttatatttgaaa
gatgaaacacgcaaccctactggtagcttcaaggatagatgcatgagtgtttcggtatct
atggctaagtatttcgggtttaagagagcggtggtggctagtagtggtaacgctgcagct
gcgttggctgcttatggtgctagagcaggtattgaagtatatgcttttgtccctgacttc
gcaggatacggtaagatcgctcaattattgttctatggtgcaaaagttttcagagttaga
tgggttgaagcagaggatccaactgttaaaatgatgaggttattagcggagaaatatggt
ttctatccatcaccgagtttcggaccatttaatccataccagattgaaggcccgaaaact
atagctatggagatcgttgagcaacttggatgggatgttcctgaccaagtattcgtacca
acaggtgctgcaagcttgttgacaggggtctataatggttttcgtgattggaacaatgtt
ggatggataaataagtatccgagaatggttgctgtacagcctgagggtaatcatccattt
gttagagcatggatggaaaaagcagaccccaataagataaagccttgggagaagcctcca
gaaacaattgctacaggtctcgaagacacttttccatgggatggagatgcagggctaaga
gcactatataatactaatggttacggagtagtagtcagtgatgaagaaatactggaggct
atgaagcttttagccagcttagaaggattgttcgctgaacccagtggtgcagcaggtctt
gcaggattaattaaagcattagaggatggaaaagtagatagagatgaaacaatagttgtg
cttgtaacaggtcatggcctaaaggatccagatattgttaagaagacggctggagatgca
ccaactataaatcccgaccctcaagaattcttcgctaaagctaaagagttctacaaagtt
gatttcaactag

DBGET integrated database retrieval system