KEGG   Staphylothermus marinus: Smar_0098Help
Entry
Smar_0098         CDS       T00485                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
smr  Staphylothermus marinus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Smar_0098
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Smar_0098
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Smar_0098
Enzymes [BR:smr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Smar_0098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(97438..98739)
Genome map
AA seq 433 aa AA seqDB search
MVDEHIRSSQTPDILPSYWYNILPDLPEPIPPMRLGTGEIVKPEMLEKLFTHTVVKQEFS
MERYISIPSDLRKTYLEIGRPTPLLRAKRLEEYLNTPARIYYKYEGVTPTGSHKVNTALA
QAYYASREGIDRLTTETGAGQWGSALSLAGSMFGLKITVYMVRISYLQKPYRKTVMELYG
AEIYPSPSDKTEIGRKILLENPDHPGSLGIAISEAIWDAIHSENTKYSLGSVLNHVLLHQ
TVIGLEAKKQLEEIGVYPDIVIGCVGGGSNFAGISYPFIRDKLKESSNIRFIAVEPEAAP
SMTKGEYRYDFGDSAGLTPLIKMYTLGYKYIPPPIHAGGLRYHGLAPSLSILVKHGIVEP
RAYTQKQIFEAGKLFARTEGIIPAPESAHAVKAVIDEAIKAREENKEKIILFNLSGHGLL
DLKGYRDFLDGKI
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggtagatgaacatattaggtcttctcaaacacccgatattctaccaagttattggtat
aatatcttgcctgatctgccagaacccattcctccaatgaggctcggcacaggtgaaata
gtaaagccggaaatgttagagaaactctttactcatacagtagttaagcaagagtttagt
atggaaagatatataagtatacccagtgatcttcgaaaaacatacctagaaattggtaga
ccaacaccactacttagagcaaagcgtttagaagagtatttgaatactcctgctagaatc
tattataaatatgaaggagtaacccctactggtagccacaaagtcaatactgcactagcc
caagcatattatgcatctagagaaggaatcgataggttaaccactgagactggtgcgggg
caatggggttcagcacttagtcttgcgggatcaatgtttggactaaaaataactgtatac
atggttagaataagctatttacagaaaccataccgtaaaacagtaatggagctatatggt
gcagaaatatatcccagtcccagcgataaaacagagattggtagaaaaatattattggaa
aatcctgatcatcctggaagtttaggaatagcgataagcgaggcaatatgggatgcgata
catagtgaaaacacaaaatattctctcggatcagttctgaaccatgtcctactacaccaa
acagtaattgggctggaagcaaagaagcaacttgaagaaataggcgtttaccctgatata
gtaataggatgtgttggtggaggaagcaattttgcaggaatatcttatccatttataaga
gataaattaaaagaatccagtaatattaggttcatagctgttgagccggaagcagctcca
tctatgactaagggagaataccgttacgattttggagactcagcaggtttaactcctcta
atcaaaatgtacactctcggatacaagtatataccgccacctatacatgctggaggactg
agatatcacggattagcaccatcactaagcatattggtgaagcacggaatagttgaacct
agagcgtatacgcagaaacaaatattcgaagctggcaaattatttgctagaacggagggt
ataattcccgcacccgaatcagcacatgcagtaaaagccgttattgatgaagcaataaaa
gcccgtgaagaaaacaaagaaaaaataatattgttcaatctaagtggccatggattgcta
gatttaaagggttatcgtgatttcttggacggaaaaatataa

DBGET integrated database retrieval system