KEGG   Staphylothermus marinus: Smar_0185Help
Entry
Smar_0185         CDS       T00485                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
smr  Staphylothermus marinus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Smar_0185
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Smar_0185
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Smar_0185
Enzymes [BR:smr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Smar_0185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
195556..196866
Genome map
AA seq 436 aa AA seqDB search
MAVKVKCLKCGFESNNYRGYKCPNCGSLLEVIHDFEWIIEWENNGIWIFSKMLPQTNHRI
SLGEGWTPLIRSDNLFRNENIYFKDESRNPTGSFRDRAAALIVSDALDQGAKRLVVASDG
NMGASIAAYSAKAGLPVTIYVPVWTDPEKILLMKAYGAKVIVSEEDLDTLLQYVERRARK
EKLYNASSTYNILAMEGLKTIGYEIYLQYGGVPSTVYVPLGSGLTILSLYHGFSEMHSNN
IIDHIPKLIGVETCANPVYSSIHGNPTKCNEEPMPGLYYRKPVLKEYVSEIIDKHGETIV
VNNKQVYMAAKKLAMEEGLFVEPSSAVALAGALKIGGTENSIILLTGHGLKSPTPYTRPS
RERYTPFPGSTKSLILKIISEKPGLTGYEIWKRLGLRISVQAVYQHLKELEKIGLIYSKF
SENRKLYFPVYKKSSS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
ttggcagttaaggtaaaatgtttgaaatgtgggtttgaaagtaataattatagaggctat
aaatgccctaactgcggctcactcctagaagtaatccatgattttgaatggattatagaa
tgggaaaataatggtatatggatattttcaaaaatgcttccacaaactaatcacagaata
tcactgggtgagggatggaccccattaattagatcagataatctcttcagaaatgaaaac
atatatttcaaagatgaaagtaggaatccaactggtagttttagagatagagcagctgca
ttaatagtgagcgatgcattagatcagggtgctaagaggttagttgttgcaagcgatgga
aacatgggtgcgagcattgctgcttattcagctaaagcaggattacctgttacgatatat
gttcctgtatggactgatccagaaaaaatattattaatgaaagcttatggtgcaaaagta
attgttagtgaagaggatctagacactctactacaatatgttgagagaagagctaggaag
gaaaaactctacaatgcatcaagcacttataacatattagctatggaggggttgaaaact
attggttacgaaatatatctacagtacggaggggttcctagtacagtatatgttccacta
ggtagtggattaacaattctaagcctctatcatgggttctcagaaatgcattcaaacaat
attattgatcatatacctaaacttataggtgttgaaacatgtgctaatcctgtatactcc
tctatacacggcaaccctactaagtgtaacgaagaaccaatgcccggcttatattataga
aagcctgtgttgaaagaatatgtttcggagatcatagataaacatggagaaacaattgtt
gtgaacaataagcaagtatatatggcagctaagaaactcgcaatggaagagggattattt
gtagagccttcctccgcggttgcattagctggagcactcaaaatcgggggaactgagaac
tcaataatattactgactggacacggactaaagagtccaaccccctatactagacctagt
agagaaagatacactccatttccaggctctaccaagtcgctaatattgaaaattatatct
gaaaaaccaggtttgactggatatgaaatatggaaaagacttgggttaagaatatctgtt
caagctgtttatcagcatctgaaggaattagaaaaaattggacttatatattctaagttc
tcggaaaacagaaaactatattttccagtatataagaagtcaagtagttga

DBGET integrated database retrieval system