KEGG   Staphylothermus marinus: Smar_0185Help
Entry
Smar_0185         CDS       T00485                                 

Definition
(GenBank) transcriptional regulator
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
smr  Staphylothermus marinus
Pathway
smr00260  Glycine, serine and threonine metabolism
smr00750  Vitamin B6 metabolism
smr01100  Metabolic pathways
smr01110  Biosynthesis of secondary metabolites
smr01120  Microbial metabolism in diverse environments
smr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Smar_0185
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Smar_0185
Enzymes [BR:smr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Smar_0185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP HTH_11 HTH_24 MarR HTH_5 PadR TrmB HypA HTH_20 Ribosomal_L37e 3HCDH_N B-block_TFIIIC RPA_C LexA_DNA_bind zf-ribbon_3
Motif
Other DBs
NCBI-ProteinID: ABN69298
UniProt: A3DKY8
Position
195556..196866
Genome map
AA seq 436 aa AA seqDB search
MAVKVKCLKCGFESNNYRGYKCPNCGSLLEVIHDFEWIIEWENNGIWIFSKMLPQTNHRI
SLGEGWTPLIRSDNLFRNENIYFKDESRNPTGSFRDRAAALIVSDALDQGAKRLVVASDG
NMGASIAAYSAKAGLPVTIYVPVWTDPEKILLMKAYGAKVIVSEEDLDTLLQYVERRARK
EKLYNASSTYNILAMEGLKTIGYEIYLQYGGVPSTVYVPLGSGLTILSLYHGFSEMHSNN
IIDHIPKLIGVETCANPVYSSIHGNPTKCNEEPMPGLYYRKPVLKEYVSEIIDKHGETIV
VNNKQVYMAAKKLAMEEGLFVEPSSAVALAGALKIGGTENSIILLTGHGLKSPTPYTRPS
RERYTPFPGSTKSLILKIISEKPGLTGYEIWKRLGLRISVQAVYQHLKELEKIGLIYSKF
SENRKLYFPVYKKSSS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
ttggcagttaaggtaaaatgtttgaaatgtgggtttgaaagtaataattatagaggctat
aaatgccctaactgcggctcactcctagaagtaatccatgattttgaatggattatagaa
tgggaaaataatggtatatggatattttcaaaaatgcttccacaaactaatcacagaata
tcactgggtgagggatggaccccattaattagatcagataatctcttcagaaatgaaaac
atatatttcaaagatgaaagtaggaatccaactggtagttttagagatagagcagctgca
ttaatagtgagcgatgcattagatcagggtgctaagaggttagttgttgcaagcgatgga
aacatgggtgcgagcattgctgcttattcagctaaagcaggattacctgttacgatatat
gttcctgtatggactgatccagaaaaaatattattaatgaaagcttatggtgcaaaagta
attgttagtgaagaggatctagacactctactacaatatgttgagagaagagctaggaag
gaaaaactctacaatgcatcaagcacttataacatattagctatggaggggttgaaaact
attggttacgaaatatatctacagtacggaggggttcctagtacagtatatgttccacta
ggtagtggattaacaattctaagcctctatcatgggttctcagaaatgcattcaaacaat
attattgatcatatacctaaacttataggtgttgaaacatgtgctaatcctgtatactcc
tctatacacggcaaccctactaagtgtaacgaagaaccaatgcccggcttatattataga
aagcctgtgttgaaagaatatgtttcggagatcatagataaacatggagaaacaattgtt
gtgaacaataagcaagtatatatggcagctaagaaactcgcaatggaagagggattattt
gtagagccttcctccgcggttgcattagctggagcactcaaaatcgggggaactgagaac
tcaataatattactgactggacacggactaaagagtccaaccccctatactagacctagt
agagaaagatacactccatttccaggctctaccaagtcgctaatattgaaaattatatct
gaaaaaccaggtttgactggatatgaaatatggaaaagacttgggttaagaatatctgtt
caagctgtttatcagcatctgaaggaattagaaaaaattggacttatatattctaagttc
tcggaaaacagaaaactatattttccagtatataagaagtcaagtagttga

DBGET integrated database retrieval system