KEGG   Staphylothermus marinus: Smar_0241Help
Entry
Smar_0241         CDS       T00485                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
smr  Staphylothermus marinus
Pathway
smr00010  Glycolysis / Gluconeogenesis
smr01100  Metabolic pathways
smr01110  Biosynthesis of secondary metabolites
smr01120  Microbial metabolism in diverse environments
smr01130  Biosynthesis of antibiotics
smr01200  Carbon metabolism
smr01230  Biosynthesis of amino acids
Module
smr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:smr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smar_0241
Enzymes [BR:smr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Smar_0241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N GFO_IDH_MocA CoA_binding 2-Hacid_dh_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABN69354
UniProt: A3DL44
Position
254891..255937
Genome map
AA seq 348 aa AA seqDB search
MSKIRVGVNGYGTIGKRIADAVAKMPDMELVGIVKVTPDYGYLVAEQKGIPVYTIKDRID
KFKDKGFKVEGTIEDLLEQIEIIVDATPGGYGFYYKEKYYEKLINKGKLKAIYQGGEKSE
VADISFNAYCNAEEALKANSIRIVSCNTTGLLRVICVLNNAFGVEKVRATIIRRAADPKE
DKRGPVNSVKLNPPKIPSHHALDVKTVMPNIDIETAAVIVPTTLMHVHSVYMVLKTKVRV
DEIIDELSNYNRILVIDAEKTGIDSTAKIVEAARDLLRSRYDIPELIIWKDSIYTRENEL
WFLQAVHQESIVVPENIDAIRGLARTDGYPDKSIKLTDSVLGIGKFLG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
ttgtctaaaatacgagttggcgtaaatggttatggaactattgggaaaagaatagctgat
gcagtagctaagatgcctgatatggaactagtaggtattgttaaggtgacaccagactat
ggatacttggtagcggagcaaaaaggtatacctgtctatacaataaaggatcgtatagat
aaatttaaggataaaggtttcaaagttgagggaacaatagaggatctattggagcaaata
gaaataattgttgatgcaacaccgggaggatatggtttttattataaagagaaatactat
gaaaaactaattaataaaggaaaactaaaagcaatttatcaaggcggggaaaaatccgaa
gtagcagatataagttttaacgcgtattgcaacgccgaagaagctctaaaagcaaacagt
ataagaatagtaagctgtaacactacaggcttgctcagagttatatgtgtacttaacaat
gctttcggagttgaaaaagtaagagcaacaattatacggagagcagctgatcccaaggaa
gataagagagggccggttaactcggtaaaacttaacccaccaaaaataccgagtcatcat
gcattggatgtaaaaacagtaatgccaaacattgacatagagacagccgcagttattgtt
ccgacgactctaatgcatgttcattcagtatacatggtattaaagacaaaggttagggta
gatgaaataattgatgaattatccaattataatagaatattggttattgatgctgaaaaa
acaggaattgattcgactgcaaagatcgttgaggcagcaagagatctgctgaggtctaga
tacgatattcccgaactgatcatatggaaggatagtatatatactagagaaaatgagttg
tggtttctacaagcagtccatcaagaatcaattgttgtcccagaaaacatagatgctatt
agaggtttggcaagaactgatggttatccagataaaagtattaagttgactgattctgtt
ctaggaataggaaagtttttaggataa

DBGET integrated database retrieval system