KEGG   Staphylothermus marinus: Smar_0449Help
Entry
Smar_0449         CDS       T00485                                 

Definition
acetyl-CoA synthetase (ADP-forming) alpha subunit / branched-chain acyl-CoA synthetase (ADP-forming) alpha subunit (EC:6.2.1.13 6.2.1.-)
Orthology
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
smr  Staphylothermus marinus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smar_0449
   00620 Pyruvate metabolism
    Smar_0449
   00640 Propanoate metabolism
    Smar_0449
Enzymes [BR:smr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     Smar_0449
Lipid biosynthesis proteins [BR:smr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Smar_0449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(469459..470862)
Genome map
AA seq 467 aa AA seqDB search
MAIDNSLKPLFEPRSIAIIGASRSPGKIGHTIMKNIIEYGYKGKIYPINPKADEILGYKA
YKSVVEVPDEIDMAIIVVPEQVVPKVAEECGKKGVKVLVVITSGFSEVGNVEAERKLVEI
ARRYGMRILGPNIFGIAYTPAKLNATFGPKDVLEGPIAFITQSGALGIALMGWTIMEEIG
ISALVSMGNMADIDVIDVSKYLANDPNTKVITIYLEGLKPGTGRKFIEEMKKVTVKKPVI
VIKAGRSKRGAAAAASHTGSLAGSDNLYQAAFKQAGIIRAYTTEEMFDWARAFASQPIPR
GEETIIITNGGGVGVLATDAAEEHNVKLLDPSPELKEKFKKTMPWFGSAKNPIDLTGQAV
VENYVEALRTAFESDEIHNIILLYCRTAILDPRDLANAIVKLYGEYKGTAHSKPLVAGFV
GGEDVREAIRLLNKNGIPAYPSAERAVASIAKMIWYMRYLNKIKSRK
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
gtggcaatcgataatagtttaaaacccttattcgaacctagaagtattgcgattataggg
gctagtaggagtccaggcaagatcgggcatactattatgaaaaacattattgaatatggt
tataaaggtaaaatataccctataaatcctaaagctgatgaaatacttggctataaagca
tataagtctgttgtcgaggtccccgacgaaatagatatggcgataatagtcgttcctgaa
caggttgtcccgaaagttgctgaggaatgtggtaaaaaaggtgtaaaggtattagttgtt
attacatctggttttagcgaagtgggaaatgttgaagctgagagaaaacttgttgagata
gcacgcaggtatggtatgaggattcttggaccaaacattttcggcatagcatatacgcct
gcaaaattgaatgcaacatttggtccaaaagatgttctcgagggccctatagcatttatt
acgcaaagtggtgctttaggaatagcattaatgggttggacaataatggaagagataggt
atatcggctctcgtcagtatgggtaatatggctgatatagatgtaatagatgtttctaaa
tacttagccaatgatccaaacactaaagtcataacaatttatctagaaggactaaaacct
ggcactggtagaaaatttattgaagaaatgaagaaagttacagttaagaaacctgtaatt
gtaattaaggctggaagaagcaaacgtggagctgccgctgctgcaagccatactggaagc
ctggctggaagtgataacttgtatcaagcagcatttaaacaagcaggaataataagagca
tatactacagaggaaatgtttgattgggctagagcattcgcttcacaaccaatacctcga
ggcgaagaaacgatcattattacaaatggtggaggagtaggtgttctagcaactgatgca
gctgaagaacacaatgttaaattattagatccaagccctgagcttaaggagaaatttaag
aaaactatgccatggtttggtagtgcgaagaaccctatcgatttaactggtcaagccgtt
gttgaaaactatgtagaagcattgaggaccgcgtttgaatcagatgaaattcataatata
atattattgtattgtagaacagctattcttgaccccagagacttagcgaatgctattgtt
aaactatacggagaatataaaggaaccgctcatagtaagccgttggttgcagggtttgtt
ggcggagaagacgttcgtgaagcaattaggttattgaataagaatggtatacctgcttat
ccaagtgcggagagagctgtagctagtatagcaaaaatgatctggtatatgaggtatctt
aataaaataaaatctaggaaataa

DBGET integrated database retrieval system