KEGG   Staphylothermus marinus: Smar_0466Help
Entry
Smar_0466         CDS       T00485                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
smr  Staphylothermus marinus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:smr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Smar_0466
Enzymes [BR:smr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Smar_0466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
482765..483718
Genome map
AA seq 317 aa AA seqDB search
MSKTSSKPIHVAVGNLNIDITMYVPRLPMPDESVFAEEIMIGPGGSASNYSVAVTYYGHI
AYLIASTSLNQLIDSILEKLNSIGVYTRFIKRVEEKPGIVNVIVIPGGEKIMVKYRGANE
LLSPNDVPRQLLEEATIVHMASIPPTIASEIAMRATGLGSLVSYDPGAYALYDKEKIVSI
LDNINILFLNRSEARSITGGKVENLLKYGTDLIVIKKGPGGAYVLQHGGTVYHGVSKPIR
PPIDSTGAGDAFDAFFNAAYIDYKDPGKALSYALAAGALKVMCRGSILCWDKQLFSKQLN
ETIVEEIKEPENWILED
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagactagttcaaaaccaatacatgtagccgtaggtaatttaaacattgatata
acaatgtatgttccaagactgccaatgcctgatgaaagtgtttttgccgaagaaataatg
attggaccaggtggttctgcatctaattattcagtagcagttacttattatggccatata
gcatatcttattgcttcaacatcgcttaatcaattaatagattctatcttggaaaaacta
aactcgatcggtgtatatacaagatttattaagagagttgaagaaaaacccggcattgta
aatgtaatagtaatcccaggtggagaaaaaatcatggttaaatacagaggtgctaacgag
ttattatctcctaacgatgttcctagacaattattagaggaagcaacaatagttcatatg
gcaagtattccgccaactattgcatcagaaatagcaatgcgagccacaggcttgggctca
ctagtaagctatgatcctggagcttatgcattatatgataaagaaaaaattgtttcaata
ctggacaacataaatatcctatttcttaatagatcagaagctcgttcaattactggaggt
aaagtagagaacctactaaaatatggtacagatctaatagttattaagaaggggccggga
ggagcatatgttttacaacatggaggaacagtttatcatggagtatcaaaacctataaga
ccacctatagattctacaggtgctggagacgctttcgatgcattttttaatgctgcatac
atagattataaggatccaggtaaagcattatcatatgcattagctgcaggagcattgaaa
gtaatgtgccgtggaagcatactttgctgggataaacaattattctcgaaacaattaaat
gaaacaattgtagaagaaataaaagagccggagaactggatacttgaagactaa

DBGET integrated database retrieval system