KEGG   Staphylothermus marinus: Smar_0470Help
Entry
Smar_0470         CDS       T00485                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
smr  Staphylothermus marinus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smar_0470
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Smar_0470
   00640 Propanoate metabolism
    Smar_0470
   00660 C5-Branched dibasic acid metabolism
    Smar_0470
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Smar_0470
Enzymes [BR:smr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Smar_0470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
485507..486646
Genome map
AA seq 379 aa AA seqDB search
MKLYEFEAKEIAKNNGIPVPRGGIAKTPEEARIVAEKIGGEVVLKAQVLVGRRGLAGGVL
FASNSLEAEKVARELFSKRVRGEKVELILVEEKICIDKEYYLSLTIDRSNREIVYLVSPL
GGVEIEELVKKYPDKLLRIRVDPVIGYKPYMSRLAAKFLGLPKELWPSMHKIMNSMYNIM
KNYDADLVEFNPLVKTCSNEIVAVDAKITIDDNSLYRHIEFAEKYGRELSEMEAIAKKLG
FSYVELDGDIGIMCNGAGLTMATMDMVAYYGGRPANFLDIGGGASRERVREAAKLLLKHD
KVKVLLVNIFGGITRCNEVARGIIEAVEETGVKKPIVIRLLGTNEEIGRRLLEEKGYSVF
SEADDAVKKAVEIAKNLSR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
ttgaagttatacgagttcgaggcaaaagagatcgctaaaaacaacggtatacctgttcct
cgaggaggtattgctaaaacacctgaagaggcaagaattgttgctgagaaaattggtggc
gaagtagtgttgaaggctcaagtactggttgggagaagaggattggcaggtggagtctta
ttcgcttctaactctctcgaagctgaaaaagttgctagggaactatttagtaaacgtgtt
cgtggtgaaaaagtagagcttattcttgttgaggagaagatctgtattgataaagaatat
tatttatctctaaccatagaccgctcaaacagggaaatagtataccttgtatcccctctg
ggaggagttgagatagaagaacttgttaagaaatatccggataaattattgaggatcaga
gttgatcccgtaattggatataaaccatacatgtcgcgtttagcagctaaatttctaggt
ttaccaaaagagctatggccaagtatgcataagataatgaattccatgtataatattatg
aaaaactatgatgctgatcttgtagagtttaatccattagttaaaacttgtagtaacgaa
atagtagcagtcgatgctaagataacgattgacgataatagtctttaccgccacatagaa
tttgctgagaaatatgggagagaattatctgagatggaggctatcgctaaaaaacttgga
ttctcctatgtagagcttgacggagatattgggataatgtgtaatggcgccggattaact
atggcgacaatggatatggttgcatattatggtgggagaccagctaacttcctagatata
ggtggtggtgcttcacgtgagagagtcagggaagcagctaagctattattgaaacatgac
aaggttaaagtgcttctagtaaatattttcggcggtataactagatgtaacgaagtagct
agaggaataattgaggctgtagaagaaactggtgttaaaaaaccaattgttattagatta
cttggtaccaacgaggagataggtagaagacttctcgaagagaaagggtatagtgttttt
agcgaagcagatgatgcagttaagaaagctgttgagatagccaagaatttatcaaggtga

DBGET integrated database retrieval system