KEGG   Staphylothermus marinus: Smar_0706Help
Entry
Smar_0706         CDS       T00485                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
smr  Staphylothermus marinus
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:smr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Smar_0706
  Lipid metabolism
   00561 Glycerolipid metabolism
    Smar_0706
   00600 Sphingolipid metabolism
    Smar_0706
Enzymes [BR:smr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Smar_0706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
713205..714587
Genome map
AA seq 460 aa AA seqDB search
MPESSKIKISIIGAGSAVWSIPVLIDIMLKKSLANADVYLMDIDLDRLKLVYGFAKRYAE
EIHSTVKFHMTTDRVEAIRDADFVINSAMAMGHSYYERMREISEKHGYYRGINSVEWNMV
SDYHTIWGYYQFKLAMSIARNIEEYAPDAWLLNVANPVFELTTLISRKTKVKMIGLCHGH
MGFENVIRELKLPKDKVEAEIIGFNHVIWLTKFKVDGEDGYKFLDKWIVTEADKYWKKWR
ETTANPFDIDLSPAAIDMYKNYGLLPIGDTVRGGTWKYHWNLETKKKWYGPYGGPDSEIG
WAMYVAFLKMRLYEIYKAITDTSRPLTLLFPPKPSGEQVIELIDSMVTGTPRTFQVNILN
NGSIPGIPDNVAVEMPAVIDDKGVHRKTFPPLPSKIQKYVIYPRMMRMEWALEAFLEGGR
DKLFEWLIYDPRTKSTRQVEETIDDLLKMPGNEEMAKHYS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgaatcatccaagatcaaaataagtattataggtgctggttctgctgtatggtct
attcctgtattaatagatataatgttgaagaagagcttagctaatgcagatgtgtatctc
atggatattgatcttgaccggttaaagcttgtatatggatttgctaagagatatgctgaa
gaaatacattcaacagtaaaatttcacatgaccactgatagagtagaagcgattagggat
gctgatttcgtaataaatagtgctatggctatgggtcattcatactatgagagaatgagg
gagatcagtgagaaacacggatactataggggaataaatagtgttgaatggaacatggtg
agcgattatcatactatttggggatactaccagttcaaactcgctatgagtattgcaagg
aatatagaggagtatgctccagacgcgtggctgttaaatgttgctaatccagtatttgaa
ttaacaactctaattagtagaaagacaaaagtgaaaatgatcggtttatgtcatggacat
atggggttcgagaatgttatacgagaactaaaacttcccaaagataaagtagaagctgaa
ataatcggtttcaaccatgtgatttggctaacaaaattcaaagtagacggtgaagacggc
tataagttcttggataaatggatagtgacagaagctgataagtactggaagaaatggaga
gaaacaacagctaaccccttcgacatagacttatcccccgcagccatagacatgtataaa
aactacggcttactcccaataggagatactgttagaggaggaacatggaaataccactgg
aacctagaaacaaagaagaaatggtatggaccatatggagggccggattcagaaataggt
tgggcaatgtatgttgcttttctgaaaatgagactatacgaaatctacaaagctataacc
gatacatcaaggcctctaacactattattcccgcctaaacccagtggtgaacaagttatt
gaactaattgattccatggtgacaggtacacctagaacttttcaagtcaatatattaaat
aatggatcaatacctggtataccagataatgtagctgttgaaatgccagctgtaattgat
gataaaggtgttcatagaaaaacattccctccattaccatcgaagatacagaaatatgtc
atatatcccagaatgatgagaatggaatgggctctcgaagccttcctagaaggtggtaga
gataaattatttgagtggctaatctatgatccaagaacaaaatctactagacaagtagag
gaaacaatagatgatctattaaaaatgcctggaaacgaagaaatggctaaacactattca
taa

DBGET integrated database retrieval system