KEGG   Staphylothermus marinus: Smar_0884Help
Entry
Smar_0884         CDS       T00485                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
smr  Staphylothermus marinus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Smar_0884
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Smar_0884
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Smar_0884
Enzymes [BR:smr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Smar_0884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
865320..866387
Genome map
AA seq 355 aa AA seqDB search
MAKKEAYWYCPKCGFKESIWNNYYWKCPKCGSPIEIIYDKTFEPRGNGLHRYSSLFPFKP
VKTVGEGGTPLVVDEENNAKLLFKLEYLNPSGSFKDRGTALAIGYGYLLGYKSVVEDTSG
NTGISVTLYSRVYGLKPLIIMPKNAPLGKKKLVKLLGGEIIEAKNRGEASKIVSNYVKSS
YYVAHIWSYFYIIGASTISYEVYEEYGVPDYMIVPVGSGGLFLGLMNGFEYLYTQGLIRH
VPKPVVVQGYSVQPVYEKLYGEKIAGEESDLADGIMVPEPPRINEILEYIGKYNGKIVLV
GNSEIKQALQELLDKGFIVEPTSATVYAAYKKMIDEFRGKEVLLPLTGSGLKMVS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaaaagaagcttattggtattgtccgaaatgcggcttcaaagaatctatttgg
aacaattactattggaaatgtcctaagtgtggttcacctatcgagataatatatgataaa
acatttgaacctcgaggaaacggattacatagatatagttcattatttccttttaaaccc
gttaaaacggttggtgagggaggaacacccctagttgtagatgaggagaacaatgctaag
ttattatttaagctggaataccttaatccctcagggagcttcaaggatcgaggaacagcg
cttgctatcggatatggttatcttttaggatataaatctgtagtggaggatacaagtgga
aatacaggtatatctgttactttatactctagagtatatggattaaaacctttgatcata
atgcctaaaaatgctcctctagggaaaaagaagctagtcaaattattgggtggtgaaata
attgaggctaaaaatagaggtgaagcttctaaaattgtttcaaactatgttaagtcctca
tattatgtagctcatatatggagctacttctacataattggtgcttcaactatttcttat
gaagtatatgaggaatatggtgtacccgattatatgattgtaccagtgggttcgggtgga
ttattcctaggattaatgaatggttttgagtatctatatactcagggattaataagacat
gttccgaaaccagttgttgttcagggatatagtgttcagccagtatacgagaaactatat
ggtgaaaaaatcgctggtgaagaatcggatctagctgatggtataatggttcctgaacct
ccccgtatcaatgagatattagagtatattggaaaatataatggcaaaatagttcttgta
ggaaatagtgaaattaaacaagcccttcaagaactattagataaaggattcattgttgaa
ccaacctcagccacagtatatgctgcatataagaagatgatagatgaatttagaggtaaa
gaagtattattaccactaacaggttcaggattaaaaatggttagctaa

DBGET integrated database retrieval system