KEGG   Staphylothermus marinus: Smar_0901Help
Entry
Smar_0901         CDS       T00485                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
smr  Staphylothermus marinus
Pathway
smr00010  Glycolysis / Gluconeogenesis
smr00051  Fructose and mannose metabolism
smr00562  Inositol phosphate metabolism
smr01100  Metabolic pathways
smr01110  Biosynthesis of secondary metabolites
smr01120  Microbial metabolism in diverse environments
smr01130  Biosynthesis of antibiotics
smr01200  Carbon metabolism
smr01230  Biosynthesis of amino acids
Module
smr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:smr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smar_0901
   00051 Fructose and mannose metabolism
    Smar_0901
   00562 Inositol phosphate metabolism
    Smar_0901
Enzymes [BR:smr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Smar_0901
Exosome [BR:smr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Smar_0901
  Exosomal proteins of bladder cancer cells
   Smar_0901
  Exosomal proteins of melanoma cells
   Smar_0901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG Trp_syntA IGPS FMN_dh His_biosynth NMO CutC
Motif
Other DBs
NCBI-ProteinID: ABN70001
UniProt: A3DMZ1
Position
complement(883545..884246)
Genome map
AA seq 233 aa AA seqDB search
MSLKPIVAVNYKAYYPYSFGEHALRIARDAVKVWKETGVDIILAPPYTELYRVLKEVEGT
DIKVFAQHADPVEPGAKTGYIPLEALKELGVHGVILNHSEHRLKLADINWLIKKAKKLGL
QTLVCADVPETGAAVAVLEPDMVAVEPPELIGTGIPVSKAKPEVITRSVELIRKVNKDIV
ILTGAGISRGEDVYAAVKLGTLGVLVASAIVKSDNPYQVMKDMALNGLKALEK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgagtttaaaacctattgttgcagtaaattataaagcatattatccttatagcttcgga
gaacatgctttacggatagctagagacgctgtcaaagtatggaaggagacaggtgtagat
attattctcgcacctccatatacagagctttaccgtgtattaaaagaagtagaaggaaca
gacattaaagtatttgcccaacacgctgaccctgtagaaccaggtgctaaaacaggatat
atcccattagaagctttaaaagagctaggtgtacatggagtaattctaaatcatagcgag
catagattaaaactagccgatataaactggttaatcaagaaagccaagaagctaggatta
caaacactagtatgtgcagatgttccagagaccggtgcagcagtagctgtactagaacca
gatatggtcgctgtagagcctccagaactcataggaacaggtatacctgtaagtaaagct
aaacccgaagttataacgagaagtgttgagttgataaggaaagtaaacaaagacatagta
atacttacaggcgcaggtattagtagaggtgaagatgtatacgctgctgtaaaacttgga
acattgggagtactagtagcatcagcaatagttaaatctgataatccataccaagtaatg
aaagatatggcactgaatgggttaaaagctctagaaaaataa

DBGET integrated database retrieval system