KEGG   Staphylothermus marinus: Smar_0902Help
Entry
Smar_0902         CDS       T00485                                 

Definition
D-fructose 1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
smr  Staphylothermus marinus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smar_0902
   01230 Biosynthesis of amino acids
    Smar_0902
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smar_0902
   00030 Pentose phosphate pathway
    Smar_0902
   00051 Fructose and mannose metabolism
    Smar_0902
  Energy metabolism
   00680 Methane metabolism
    Smar_0902
Enzymes [BR:smr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Smar_0902
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Smar_0902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(884310..885482)
Genome map
AA seq 390 aa AA seqDB search
MSEGEKITLSIIKADVGSMSGHVMPHPDQLAAATKVLAEAKQKGLLIDFYVTHVGDDIQL
IMTHRKGVDAPEIHELAWNAFQAAAKVAKELKLYAAGQDLLSDAFSGNVRGLGPGVAEIE
MVERKAETVITFHADKTEPGAFNLPIFRIFADPFNTAGLVIDPRMHEGFIFEVYDVFEGK
SVKLSAPEEMYDILALIGTPSRYVVRRVYRKSDNLQAAVVSVERLNLIAGKYVGKDDPVA
IVRAQHGLPAVGEVLEAFSFPHLVAGWMRGSHHGPLIPVPQRYARVTRFDGPPRVMALGW
NIAKGRLIGPVDLFDDVAFDETRKLGVQIAEYMRRHGPFMPHRLGPEEMEYTTLPAVLEK
LKDRFVKTEEVHVIKRHSALLSGTSEEEHD
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagggtgaaaagataactttatcaattattaaagcagatgttggatcaatgtct
gggcatgtaatgcctcatcctgaccagttagcagcagccactaaggtattagctgaagct
aagcagaagggattgttaatagacttctatgtaacacatgttggtgacgacatacagctg
ataatgactcatagaaaaggagttgatgctccagaaatacatgagttagcatggaatgct
tttcaagctgcagcaaaggttgctaaagagctaaaactatatgctgctggacaagacttg
ttaagtgatgcattctcaggaaatgtccgaggccttggtccaggtgtcgcagaaattgag
atggttgagagaaaagcagaaacagtgattacattccacgcggataaaaccgagcctgga
gcatttaatttacctatcttcagaatatttgctgacccattcaacactgctggtttagta
attgatccaagaatgcatgaaggcttcatattcgaagtctacgacgtatttgaaggtaaa
tctgttaagcttagcgctcctgaggaaatgtatgatatactagctttaatagggacccct
agcaggtatgtggttagaagagtttatagaaaaagcgacaacttacaagcagctgtcgta
agtgttgagaggttgaatttaatcgctggaaaatacgttggtaaagatgatcctgtagct
atagttagagcacagcatggattaccagctgtaggagaggtacttgaagcattctcattc
ccacacctagtagctggctggatgcgtggcagtcatcatggtccgttaatacctgttcca
cagagatatgctagggttacaagatttgatggaccaccacgtgtaatggcgcttggctgg
aatattgctaaaggcagacttattggcccagtagacttgttcgatgatgtggcatttgac
gagacaagaaaactaggtgtacaaatagcagaatacatgaggcgccacggaccattcatg
cctcaccgtctaggaccagaagaaatggaatacactacgctaccagcagtattggagaag
cttaaagatagatttgtgaagacggaagaagtccacgtaattaaaagacatagtgcatta
ttatctggaactagcgaagaagaacatgattaa

DBGET integrated database retrieval system