KEGG   Staphylothermus marinus: Smar_1072Help
Entry
Smar_1072         CDS       T00485                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
smr  Staphylothermus marinus
Pathway
smr00010  Glycolysis / Gluconeogenesis
smr00071  Fatty acid degradation
smr00350  Tyrosine metabolism
smr00625  Chloroalkane and chloroalkene degradation
smr00626  Naphthalene degradation
smr01100  Metabolic pathways
smr01110  Biosynthesis of secondary metabolites
smr01120  Microbial metabolism in diverse environments
smr01130  Biosynthesis of antibiotics
smr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smar_1072
  Lipid metabolism
   00071 Fatty acid degradation
    Smar_1072
  Amino acid metabolism
   00350 Tyrosine metabolism
    Smar_1072
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Smar_1072
   00626 Naphthalene degradation
    Smar_1072
Enzymes [BR:smr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Smar_1072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ABN70170
UniProt: A3DNG0
Position
complement(1035506..1036510)
Genome map
AA seq 334 aa AA seqDB search
MKAMVLYEPKPVEKNPLKLSDVDIRDPRGDEVLLEISCCGVCRTDLHIVEGELKPIKLPL
IPGHQVVARVKEVGENVDNVSKGMRVGVPWLYWACGKCKYCRRGLENLCDHALFTGYSVD
GGYAEYMIAKKDFVHPLPNTHDDCKAAPLLCAGAVGYRALRLTGLVDKRDGILGLFGFGA
SAHLILQAAKALGLTVYVFTHSPWKIEYAYKLGADWAGDTKETPPNKLDAAIVFAPVSWV
FIEALKKLDKGGRVVLGEIYMSPIEKLDYKLLWLEREVKTTANVTRRDVREFLDIASKYR
IYPDITIYKLEEANKALQDLKHGKIKGQAVLKIK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagccatggttctctacgagcctaaacctgtagagaagaatccattaaagcttagt
gatgttgatataagggatccgcgtggagacgaagtattattagagatatcatgttgtgga
gtttgtaggactgatctacatattgttgagggggaactcaagcccattaaattacctctc
atacctggtcatcaagtagtggctcgggtaaaagaggttggggaaaatgttgataatgta
agtaaaggtatgagagtaggagttccatggctttactgggcatgtgggaaatgcaagtat
tgtaggagagggttagaaaacctatgtgatcatgcattatttactggatacagcgttgat
ggaggatacgctgaatacatgatcgctaagaaagactttgtacatccacttccaaatact
catgacgattgtaaagccgctcctctactatgcgctggtgctgttgggtatagagctcta
cgcttaactgggctagtagataagagagatggtatactaggcttattcgggtttggtgcg
tcagcacatctaattctccaagctgcaaaagcacttggtttaactgtttatgtattcaca
catagtccatggaagatagagtacgcatataagctcggagcagattgggctggagataca
aaagaaacaccacctaacaaattggatgcagcaatagtgttcgcacccgtatcatgggtc
tttatcgaagcattgaaaaaactagataagggcggaagagttgttttaggagaaatctat
atgtcgccaattgagaaacttgattataaactattatggttagagagagaagtaaaaaca
acagctaacgttacacgtagagatgtccgggaatttctagatatagcgtcaaagtacaga
atatatcctgatataacgatttataaattggaagaagccaacaaggcgttacaagacctt
aaacatggaaagatcaagggccaagctgttttgaagataaaataa

DBGET integrated database retrieval system