KEGG   Staphylothermus marinus: Smar_1169Help
Entry
Smar_1169         CDS       T00485                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
smr  Staphylothermus marinus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smr00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Smar_1169
Enzymes [BR:smr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Smar_1169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1137548..1138150
Genome map
AA seq 200 aa AA seqDB search
MNEAEMLVHSMKLLVSLGYTNPKGGNGSIRVDDHHILITPSSIPKHLLRTDDLVLYNIVN
NSYTGKYKPSIEVNAHVKTYRVRNDIHAILHAHLPLATSLTDIGLENWWLAGTVEAEYSL
EKVYVSEYAPPGSIELAEKIAEGFRSGAKIVIIPKHGVFAGGKDVADALDAIIALESTAK
YVYVKLVVEELRNIKNKLIH
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagccgaaatgcttgttcattctatgaaactcctagttagtcttggctatact
aatccgaaaggtgggaatggaagtattagggttgatgatcaccatatattgataactcct
agcagtattcctaagcatttgttgagaacagatgatctagtattatataatattgtaaat
aattcgtatactggtaaatacaaaccaagcatagaggttaatgcacatgtaaaaacatat
agggttcgaaacgatattcacgcaatactacatgcacacttaccattagctacatcacta
acagatataggtttagaaaactggtggcttgcaggcaccgttgaagcagaatatagtctt
gaaaaagtatacgtatcggagtatgcgcctccaggctccatagaacttgctgagaagatt
gcagaaggttttaggagtggtgcaaaaatagttattatacctaaacatggagtatttgcc
ggcggtaaagatgttgcagatgctttagatgctataatagctttagagtcgacggcgaaa
tatgtatatgtaaaacttgttgttgaggaactaaggaatataaagaataaactaatacat
tga

DBGET integrated database retrieval system