KEGG   Staphylothermus marinus: Smar_1199Help
Entry
Smar_1199         CDS       T00485                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
smr  Staphylothermus marinus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:smr01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:smr00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1165858..1167684
Genome map
AA seq 608 aa AA seqDB search
MYGWWGRILRIDVSKRKYVVQELDPSIYSNYIGGRGLAVKILWDELVPGVDPLSPYNKLV
IASGPLSGLPLPSSGKLVVASKSPLTNGYGDGNIGTMASVHLRKAGYDAIVLEGASDKPI
YLYIENDNVEFMDADDLWGRDTFDAEDKLVREHGRNIGVLLIGPAGENLVRYATIVSMKG
RSGGRPGMGAVMGSKKVKAIVIKGTKNPPIADEKKLRELSEASYKEILSKENYDFWIRQG
TMATIVWSNENSVLPTMNFREGVWEYYDTISGDLMEKLKVERRGCPYCNMQCGNVILDEK
GEKSELDYENVAMLGSNILLPDLRKVAELNKLADMYGIDTISLGNSLGFIMEASEKKLIR
EKVEWGDYGEVKELVKDIAHRRGLGAFLAEGVWRMSLSLGREAQDFAMHAKGLEVSAYNC
HAAPGMALAFATSPIGAHHKDAWLIGLEVKMDRFAYNREKVEKLIFLQRVRGGMFESLTT
CRLPWVELGLNLDYYPKILSATTGIEWSMDDIYRVADRIYTLIRAFWIREYNGWSRIMDY
PPMRWFKHPLTKGPFAGVKLDISKYDKMLSIYYEIRGWDERGVPKKETLEKLDLKDVIPV
LDSIVGLR
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgtatggttggtggggtcggattctcagaatagatgtgtctaagaggaaatatgttgtt
caagaactcgatcccagtatttatagtaactatataggtggcaggggtcttgcagttaag
attctatgggatgagctggtgcctggagtagatcctttatctccatataataaattagta
attgcatcagggccattatcgggtttacctctacctagtagtggtaaactagttgttgct
tctaagagtccgttaactaatggttatggtgatggaaacataggtactatggctagtgtt
catcttagaaaagctggttatgacgcaatagtattagagggtgcttcagataagcctatc
tacttatatattgagaatgataatgtcgagttcatggatgcagatgatctatggggtagg
gatacttttgatgcagaagataaacttgtccgagaacatggtagaaacattggtgttctc
ctaataggtcctgcaggcgagaatcttgtaagatatgctacaattgtttccatgaaaggt
aggagcggtggaagaccgggtatgggtgcggttatgggttccaagaaggttaaggcaata
gtaattaaaggcacaaagaaccccccaattgctgacgagaaaaaacttagagagctcagc
gaggcctcatataaggaaatattatctaaggaaaactatgatttctggattagacagggt
acaatggcaactattgtttggagcaatgaaaacagcgtattaccaaccatgaatttcaga
gagggtgtttgggaatactatgatacaatcagcggtgatctcatggagaaactaaaagtt
gagagaagaggatgcccatactgtaacatgcagtgtggaaacgttatattagatgaaaaa
ggtgagaagagcgagctagactatgaaaatgttgcaatgcttggaagcaacatcttattg
cctgatttgagaaaagtcgctgaactcaacaagttggcggatatgtatggaatagacact
atttctctaggaaatagtttaggcttcattatggaggcctctgaaaagaagcttattaga
gagaaagttgagtggggagactatggagaagtcaaggaactagttaaagacatagctcat
aggcggggattaggagcttttctagcagaaggagtatggagaatgtcgttatctctcggc
agagaagcacaagattttgcaatgcatgcaaagggattagaagtatcagcatataactgt
catgcagccccaggcatggcattagcttttgccacatcacctataggagcacaccacaaa
gatgcatggctcattggtttagaagttaaaatggatagattcgcctataatagggagaag
gttgagaaactaatattcctgcaaagagttaggggaggaatgtttgaatcactaacaact
tgtaggcttccatgggttgagctaggattaaacctggattattatcctaaaatattatca
gctacaacaggcattgagtggagcatggatgacatatacagagttgccgatagaatatat
acattgatcagagcattctggataagagaatataatggatggagccgtataatggattat
ccgccgatgagatggtttaagcacccattaaccaaaggcccgtttgcaggcgttaaacta
gatattagcaaatacgataagatgctaagtatttactatgaaatacgtggatgggatgaa
agaggggtcccgaagaaagaaactttggagaagctagacttaaaagatgttatcccagta
ttagacagcattgttgggctaaggtaa

DBGET integrated database retrieval system