KEGG   Staphylothermus marinus: Smar_1286Help
Entry
Smar_1286         CDS       T00485                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/subunit (EC:5.4.2.10)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
smr  Staphylothermus marinus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smar_1286
   00030 Pentose phosphate pathway
    Smar_1286
   00051 Fructose and mannose metabolism
    Smar_1286
   00052 Galactose metabolism
    Smar_1286
   00500 Starch and sucrose metabolism
    Smar_1286
   00520 Amino sugar and nucleotide sugar metabolism
    Smar_1286
  Nucleotide metabolism
   00230 Purine metabolism
    Smar_1286
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Smar_1286
Enzymes [BR:smr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Smar_1286
    5.4.2.8  phosphomannomutase
     Smar_1286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1246026..1247399
Genome map
AA seq 457 aa AA seqDB search
MGRLFGTDGVRGIINEELTPELALKLGMAIGTFFGEGSKILVGRDVRAGGYMIKSAVIAG
LLSAGVKVYDGELAPTPALQYAVKTQDFDGGVIITASHNPSKYNGIKVVAADGIEVPREK
ELEIEEIYFSQRFRRVPWRQLIYDAKPYPYVNDIYVKGVIEKVDKDLIRSKGFKIVIDPA
NSVGALTSPRIARELGVKVYTVNGHLDPTFPGREPEPIPEHLGETARTVVSIGAVLGVAH
DGDADRAIFIDDKGRVQWGDRTATILARYLVEKHPELPRKVYTAVSSSTIIEEILKPLGI
EVVWLKVGSVDISRTMQRNNDALCGFEENGGFMYPPHQLVRDGGMTLALMLEMIAKENRK
LSEIYDDLPQYHLIKTKIPMTRDKALLVVEQVKEYFKNYRQITIDGVKVISDDFWLLVRP
SGTEPLLRIMLEAKTKEKAEELLSIVKKIAEEVTGKK
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgggtagattatttggtacggatggtgttagaggaattataaacgaagagttaactcct
gagctcgcattaaagcttggaatggctataggcacattttttggtgagggatcaaagatt
cttgtgggtagagacgtccgtgcaggtggatacatgataaaatcagctgttatagccggc
ttattatctgctggcgtaaaagtttatgatggagaactagctccaacacctgctttacag
tatgctgttaaaacacaagattttgatggtggagttataataactgctagccataaccct
tctaaatataatggaatcaaagtcgtagctgctgacggaatagaggttccacgtgagaaa
gagcttgagatcgaggagatatattttagtcagagattcaggagagttccatggagacaa
ctaatatatgatgctaaaccttatccctatgtaaacgatatatatgttaaaggagttatt
gaaaaagtagataaggatctaatacgtagtaagggattcaaaatagttatagatccagct
aatagtgttggagcattaacatcgcctaggattgcaagagagcttggagttaaagtttat
acggttaacggacatttagatcctacttttccgggaagagagcctgaacctatacctgag
catctaggcgaaacagctagaactgttgttagtattggtgcggttttaggcgttgcacat
gatggagatgctgatcgagctatatttattgatgacaagggtagggtgcaatggggtgat
cgtacagcaacgatccttgccaggtatcttgttgaaaaacaccctgaactacccagaaag
gtgtatacggcggtttcatccagcactatcatcgaagaaatactaaaaccgctcggcata
gaagtagtgtggttaaaggttggaagcgttgatatttcgagaacaatgcagagaaacaat
gatgctctctgcggattcgaagaaaatggtggattcatgtatccaccacatcaactagtt
agagatggaggcatgactctagccctcatgctggaaatgattgcgaaagagaacagaaag
ctttcagaaatatatgatgatctcccacaataccacttgataaaaaccaagataccaatg
acaagagataaagcattactcgttgttgaacaagttaaagaatactttaagaactataga
caaataactattgacggtgtaaaagttatatcagatgacttctggttacttgtgaggcct
agcggcacagagcctttgctaagaataatgttagaagcaaaaactaaggaaaaagcagaa
gaactattatcaatagttaagaaaatcgctgaagaggtgacaggtaagaaatga

DBGET integrated database retrieval system