KEGG   Staphylothermus marinus: Smar_1448Help
Entry
Smar_1448         CDS       T00485                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
smr  Staphylothermus marinus
Pathway
smr00010  Glycolysis / Gluconeogenesis
smr00020  Citrate cycle (TCA cycle)
smr00620  Pyruvate metabolism
smr00640  Propanoate metabolism
smr00650  Butanoate metabolism
smr00680  Methane metabolism
smr00720  Carbon fixation pathways in prokaryotes
smr01100  Metabolic pathways
smr01120  Microbial metabolism in diverse environments
smr01130  Biosynthesis of antibiotics
smr01200  Carbon metabolism
Module
smr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smar_1448
   00020 Citrate cycle (TCA cycle)
    Smar_1448
   00620 Pyruvate metabolism
    Smar_1448
   00640 Propanoate metabolism
    Smar_1448
   00650 Butanoate metabolism
    Smar_1448
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Smar_1448
   00680 Methane metabolism
    Smar_1448
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Smar_1448
Enzymes [BR:smr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Smar_1448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_10 Fer4_9 Fer4_16 Fer4_2 Fer4_7 Fer4_17 Fer4_13 Fer4_4 Fer4_15 Fer4_8 Fer4_18
Motif
Other DBs
NCBI-ProteinID: ABN70538
UniProt: A3DPH8
Position
1420275..1420565
Genome map
AA seq 96 aa AA seqDB search
MASTPKEPRGWKDLPIGAVPYRLSTDYKTGDWRALRPVVDQGKCVKCMLCWLFCPDMAII
WDGEKIVVNYDYCKGCGICAHECPVNAISMVPEPTE
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atggcttctacacctaaagaaccccgtggctggaaagacttacctataggagcagtcccc
tatagattatcaacagattataaaacaggagattggagagcgctgagaccagttgttgat
caaggtaaatgtgttaaatgtatgctgtgctggctgttctgccccgacatggcgattata
tgggatggagaaaaaatcgttgtcaactatgattattgtaaaggatgcggtatatgtgca
catgaatgcccagttaacgcgatcagcatggttcccgaaccaactgagtga

DBGET integrated database retrieval system