KEGG   Staphylothermus marinus: Smar_1514Help
Entry
Smar_1514         CDS       T00485                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
smr  Staphylothermus marinus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smar_1514
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smar_1514
   00052 Galactose metabolism
    Smar_1514
   00500 Starch and sucrose metabolism
    Smar_1514
   00520 Amino sugar and nucleotide sugar metabolism
    Smar_1514
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Smar_1514
   00524 Butirosin and neomycin biosynthesis
    Smar_1514
Enzymes [BR:smr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Smar_1514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1483377..1484351
Genome map
AA seq 324 aa AA seqDB search
MANEYYLAIDIGATNTRIAIGSRNGIINKITYRTPREGNELSIPVKIYEEIKKNYGKYID
QIKAVGIGTIGPIDLRRGRVVNTPNLPIHTFELRDPLMEWLKKPVYVLNDAVSGAWGEKF
FGLGRNYSNIVYITMSTGIGGGAIVNDHLLLGKMGNAHEIGHIVVKYDSDIKCGCGGYGH
WEAYAGGANIPRTARVLAEKYKPLIETEAYREALRGELTPPKLFEYFRRNDLFAKYVVEE
IIDASAAGLATTINLYDPEVVTIGGSIYLYNQDILKEPIIRKALKHLVTEPPIIDTTPLG
GDIVLYGALATAINPPEDLLRFYR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaatgaatactatttagctattgatataggagcgacaaatactaggatagctatt
ggttctcggaatggaataataaataaaataacctataggactccgagggaaggaaacgag
ctgagtattcctgttaaaatatatgaggagatcaagaagaattatgggaaatacattgac
cagatcaaagctgtagggatcgggacgattggtcccatagatttgaggcggggaagagtt
gtaaacacacctaatctacccatacacacttttgaactaagagatccattgatggaatgg
ttaaagaagcctgtatatgtattaaatgatgcagtctctggtgcttggggagagaaattc
tttggtttaggcaggaattattccaacatagtatatataactatgagcacaggtattggt
ggaggagcaattgttaacgatcatctcttgctggggaagatggggaatgcccacgagata
ggacatattgttgtaaaatatgattcagatattaaatgtggttgtggaggatatggtcat
tgggaagcatatgctgggggagcaaatattcccagaacagcccgggtcttagctgagaag
tataagccattaatcgagacagaagcttatcgagaagcgttgagaggagaactaactcct
ccaaaactattcgaatactttagaagaaacgatttattcgcaaaatatgttgtggaagaa
ataattgatgcatcagcagcaggtctcgctacaacgataaacctgtatgacccagaagta
gtaactattggtggaagcatatatttatataatcaagacatactcaaagaaccaatcatt
aggaaagcacttaaacacttagtaactgagccaccaattattgatacaacacctctaggc
ggagacatagtattatatggagctttagcaacagcaattaatcctccagaagacctatta
aggttttatagatga

DBGET integrated database retrieval system