KEGG   Staphylothermus marinus: Smar_1570Help
Entry
Smar_1570         CDS       T00485                                 

Definition
ELP3 family histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
smr  Staphylothermus marinus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1529621..1531018)
Genome map
AA seq 465 aa AA seqDB search
MLSGVSVVAVMTHPIPCPFNCYYCPGGPQYNAPKSYFGNEPALRRARRNQFHPYKQVWNR
LLQYEYLKQIPSKVEVIVMGGTFLAAPQRYKEWFITMIFEALNRYPDPNPPRKWDLELAQ
LRNETARHRCVGLTIETRPDYGYEKHADEMLYYGATRVELGVQSIYDDVLLKVNRGHGVA
ETIKSTRILKDAGFKIVYHIMLGLPGSDPDRDIEMMKEIFENPDFRPDMLKIYPTEIVEG
TVLYQWWREGWYKPYDDETAVEVISEMYRYIPKYVRIMRIRRDIPAPEVVAGTKKSNLRE
YVEKRCMEKGIKINEIRFREVGLQAWKYGRYPDPKHIEITRTTYEASGGVEEFLAVEDTR
NDIIIGFLRMRIPSEKAHRPEIDSRTAIIRELHVYGPELPVGIHGESWQHKGWGAKLLRE
AERIAIEEYDAKKMLILSGIGVREYYRKYGYYRPPNSPYMHKILS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcttagtggtgttagtgtagttgctgttatgactcatccaataccatgccccttcaac
tgttattattgtcccggaggaccacaatataatgctccaaaaagctatttcggcaacgag
ccagcattgaggagagctcgtagaaaccagttccacccatacaagcaggtttggaataga
ctgcttcaatacgagtatctcaaacaaattcctagcaaggttgaagtcatagttatgggt
ggaacttttctagcggctccgcagaggtataaggagtggtttataacaatgatatttgaa
gcactcaacagataccctgacccgaatcctcctaggaaatgggatctagaattggcccag
cttagaaatgagacagctcgccatagatgtgttggtttaacaattgagactagacctgat
tatggatatgagaagcatgctgatgaaatgctatactatggtgctacacgtgttgagcta
ggtgttcaaagcatctatgacgatgtcttattaaaggttaatagggggcatggtgttgct
gagactataaagtctactaggatattgaaagatgcaggtttcaaaatagtataccatata
atgctgggacttccgggaagcgatcctgatagagatattgaaatgatgaaggaaatattt
gaaaacccagattttagaccggacatgctgaagatttaccctacagaaattgttgaggga
acagttctataccagtggtggagagagggatggtataagccatatgatgatgaaacagct
gttgaagtcatatcggagatgtacaggtatataccgaaatatgtgaggataatgaggatt
aggagagacataccagcaccagaagttgtggctggaactaagaagtctaatctcagagaa
tatgttgagaagagatgcatggagaaaggaatcaaaataaatgagatcaggtttagagaa
gtaggattacaagcttggaaatacggtagataccccgatcccaaacatatagagataact
agaacaacatatgaggcaagtggtggggtggaggagtttttagcggttgaggatactagg
aacgatatcataataggattcctacgtatgcgtataccaagcgagaaagcacatagacca
gaaatagatagtagaacagcgatcattagggaactacatgtttacggaccagaactacca
gtaggaatacatggtgagtcatggcaacataaagggtggggtgcgaagttgctgagagaa
gctgagagaatagctatagaagaatatgatgctaagaaaatgctgatactatcaggaata
ggggttagagaatactatcgaaaatacggatactatagaccaccaaacagtccatacatg
cataaaatactctcctaa

DBGET integrated database retrieval system