KEGG   Candidatus Sulcia muelleri SMDSEM: SMDSEM_129Help
Entry
SMDSEM_129        CDS       T00958                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sms  Candidatus Sulcia muelleri SMDSEM
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sms00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMDSEM_129 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMDSEM_129 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMDSEM_129 (trpA)
Enzymes [BR:sms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SMDSEM_129 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(138230..138982)
Genome map
AA seq 250 aa AA seqDB search
MNKIQQIFFKKQKNILNIYITAGYPDLESMPLIIKKLHNLNIDIVEIGIPYSDPLADGKI
IQESNTSSLKQGMNISVLFSQLKNLKIKIPIILMGYYNQFIKYGEKKFLENCIESGVSGL
ILPDLPPKIYIEKYIKLFKIYNIAFIFLITPQTSLKRIILLSRNSDYFLYIVSSNSTTGR
KNNINFSFLESIKNLKLKVPKLIGFGIRDKKSLNIAYKYAEGAIIGSAFIKALKKSSLEE
SIENFLKKIM
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaattcaacaaattttttttaaaaaacaaaaaaatatattaaatatatatata
actgctggatatcccgatttagagagtatgccacttataataaaaaaattacataatcta
aatatagatatagtagaaattggaattccatattctgatccattagcagatggaaaaata
atccaagaaagtaatacctcatctttaaaacaaggtatgaatatatcggttttattttcc
caactaaaaaatttaaaaataaaaattcctataattttaatgggatattataatcaattt
ataaaatatggcgaaaaaaaatttttagaaaattgtatagaatctggggtatcgggatta
attttaccagacttacctccaaaaatttacatagagaaatatataaaattatttaaaata
tataatattgcatttatatttttaataactcctcaaacatcattaaaacggattatactg
ttaagtaggaattctgattattttttatatatagtttcatctaattctactacaggtaga
aaaaataatataaatttctcttttttagagagtataaaaaaccttaaactcaaagttccg
aaacttattggatttggaatccgtgataaaaaatcattaaatatagcatataaatatgca
gaaggtgctattattggaagtgcttttataaaagctcttaaaaaaagttctttagaagaa
agtatagaaaattttttaaaaaaaattatgtaa

DBGET integrated database retrieval system