KEGG   Candidatus Sulcia muelleri SMDSEM: SMDSEM_130Help
Entry
SMDSEM_130        CDS       T00958                                 

Definition
putative bifunctional tryptophan synthase subunit beta/anthranilate isomerase
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
K01817  
phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
sms  Candidatus Sulcia muelleri SMDSEM
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sms00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMDSEM_130
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMDSEM_130
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMDSEM_130
Enzymes [BR:sms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SMDSEM_130
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     SMDSEM_130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(138979..140784)
Genome map
AA seq 601 aa AA seqDB search
MLKKLKICGLKYNNNISDIIDLYPDFIGFIFYDKSPRFVGYNFLAPNTIGISKVGVFVNE
KEDNLLKISLKNNLDFVQLHGTESPDYCSNISKYGIKIIKSFGIDNDFSFEEISKYRNYV
NYFLFDFKSTLYGGSGKKFSWEKIYDYNLKVPFFLSGGINSNDFDQINNLKIPSLLGIDL
NSCFEIKPGLKNIFLLKKFISRIKEKYLSDNNGLYGFFGGAYIPEMLYNNINNLKNEYNK
IIKNKFFKKKIKLLLHNYVGRPSPLFFCKNLSKLYGAKIYLKREDLNHTGSHKINNTIGQ
ALLAKEMGKKNIISETGAGQHGVATATICSLLGLKCTIFMGKVDRKRQIQNVYRMKMLGA
NIITVNSGSKTLKDSVNEAIRYWINNPECYYMIGSAVGPDPYPRMVSYFQSIISEEIKEQ
LKEKESDKLPNYIIACLGGGSNAAGIFYHFLDYESVNLIGVEASGLGVNTNKTAATIKKG
SLGVLHGSLTILMQDKYGQILEPYSISAGLDYPGIGPMHANLFYKKRATFISIPDFEAIE
AGIELASLEGIIPALESAHALACLKKISFKKNDLVIINLSGRGDKDMDTYIKHIKNKNKN
K
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaaattaaaaatctgtggattaaaatacaataataatatatccgatataatt
gatttatatcctgattttataggatttattttttatgacaaatctcctagatttgtagga
tataattttttagctcctaatacaattggtatttcaaaagtaggtgtatttgtaaatgaa
aaagaagataatttattaaaaataagtttaaaaaataatttagattttgtccaattacat
ggtacagaaagtcctgactattgtagtaatatatctaaatatggaataaaaattattaaa
tcttttggaatagataatgatttttcttttgaagaaatatctaaatatagaaattatgta
aactattttttatttgattttaaatcaactttatatggaggaagtggaaaaaaattttct
tgggaaaaaatatatgattataacttaaaagttcctttttttttaagtggaggtataaat
tcaaatgattttgatcaaatcaataatttaaaaattccctctctcttaggaatagattta
aatagttgttttgaaataaaacctggattaaaaaatatttttttgttaaaaaaatttatt
tctagaataaaagaaaaatatttatcagataataatggattatatggtttttttggaggt
gcatatattcctgaaatgctatataataatattaacaatttaaaaaatgaatataataaa
attataaaaaataaattttttaaaaaaaaaataaaattattattacataattatgttggc
agaccgtctcctttgtttttttgtaaaaatttatctaagctatatggagctaaaatctat
ttaaaaagagaagatttaaatcatactggatctcataaaataaataatacaatcggtcaa
gcgttattagctaaagaaatggggaaaaaaaatattatttcagaaactggtgcaggtcaa
catggtgtagctacggccactatttgttctttattaggattaaaatgtactatttttatg
ggaaaagtagatagaaaacgacaaatacaaaatgtatataggatgaaaatgttaggtgct
aacataataactgttaatagtggaagcaaaaccttaaaagattcagtaaatgaagctatt
agatattggataaataatccagaatgttattatatgataggatcagcagttggaccagat
ccatatcctagaatggtatcttattttcaatcaattattagtgaagaaataaaagaacaa
ttaaaagaaaaagaatccgataaactacctaattatataattgcatgtttaggagggggg
agtaatgctgcagggatattttatcattttttagattatgaatctgttaatctaataggt
gtagaagcttcaggattaggagtaaatactaataaaacagcagcaacaattaaaaaaggc
tctttaggggtattacatggtagtcttactattcttatgcaggataaatatggtcaaata
ttagaaccttattctatatctgctggattagattatcctggaattggacctatgcatgca
aatttattttataaaaaacgtgcgacttttataagtattcccgattttgaggctattgaa
gctggaattgaacttgcttctttagagggaataattccagcactagaaagtgctcatgct
ttagcatgtttaaaaaaaatatcatttaaaaaaaatgatttggtaataataaatctttct
gggagaggtgataaagatatggatacatatataaaacatattaaaaataaaaataaaaat
aaatga

DBGET integrated database retrieval system