KEGG   Candidatus Sulcia muelleri SMDSEM: SMDSEM_147Help
Entry
SMDSEM_147        CDS       T00958                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sms  Candidatus Sulcia muelleri SMDSEM
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sms00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMDSEM_147 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMDSEM_147 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SMDSEM_147 (thrC)
Enzymes [BR:sms01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SMDSEM_147 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(160577..161890)
Genome map
AA seq 437 aa AA seqDB search
MLYKSLKNNKYIASFKEAVLFGQSPDKGLYFPEKIPLLEKKFFQNISNLEVNDLMMEVIK
PFIGNEIPYKELLNIISNTVNFKINLKKIYENFFSLELFLGPTMAFKDIGVKFLSGCIKY
FCKQIKKNIIILTATSGDTGAAVANAFNKIDGVKVVILYPSSKISFLQEKQITTLGDNIL
ALEIKGNFDDCQLLAKKAFYDEQIRKKLFLTSANSINIARLLSQIFYYFLCYKLLFKKKN
NEKIIFSIPSGNFGNICAGLIAFKMGLPVKHFIAATNINDTVPRLLKSEIYNPYPTKETI
SNAMDIADPNNFSRIMYMFKHVKNIKKIFSAYSFSDQETINIIKFIWEKYKYMMDPHGAI
GYLGLKKFYFDKKNFNYKNIFLATASPVKFLDKINKKLSDQILLNEKVKKLLKKTKKSIK
LSNEYENFKNWLLTSNL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgctgtataaaagtttaaaaaataataaatatatagcttcttttaaagaagctgtttta
tttggacaaagtccagataaagggttgtattttcctgaaaaaatacctttattagaaaag
aaattttttcaaaatatttcaaatttggaggtaaatgatttaatgatggaagtaattaaa
ccatttattggaaatgaaattccatataaagaattattaaatattatttctaatacagta
aattttaaaataaatcttaaaaaaatttatgaaaattttttttcattagagttattttta
ggacctactatggcttttaaagatataggagtaaaatttttatcagggtgtataaaatat
ttctgtaaacaaattaaaaaaaatattataatccttactgctacttctggggatacagga
gctgcggttgccaatgcttttaataaaattgatggtgtaaaagtagtaatattatatcct
tcttcaaaaataagttttttacaagaaaaacagataacaacattaggggataatatctta
gctttagaaataaaaggaaattttgatgattgtcaattgttagcaaaaaaagctttttat
gacgaacaaatacgtaaaaaattatttttaacctcagccaattctattaatattgcacgt
ttactatctcaaatattttattattttttgtgttataaacttttatttaaaaaaaaaaac
aatgaaaaaataattttttctattcctagtggaaattttggaaatatatgtgcaggatta
atagcatttaaaatgggattaccagtaaaacattttattgcagctacaaatataaatgac
accgttcccagattgttaaaatctgaaatttataacccatatcctacaaaagaaacaatt
tctaatgctatggatatagctgatcccaataattttagtaggataatgtatatgtttaaa
catgtaaaaaatattaaaaaaattttttctgcatattctttttcggatcaagaaacaatt
aatataattaaatttatatgggagaaatataaatatatgatggatccacatggagcaatt
gggtatttagggttaaaaaaattttattttgataaaaaaaattttaattataaaaatatt
tttttagccacagcatctccagtaaaatttttagataaaataaataaaaaattatctgat
caaattttattaaatgaaaaagtgaaaaaacttttaaaaaaaactaaaaaaagtataaaa
ttgagtaatgaatatgaaaattttaaaaattggttattaactagtaatttataa

DBGET integrated database retrieval system