KEGG   Candidatus Sulcia muelleri SMDSEM: SMDSEM_192Help
Entry
SMDSEM_192        CDS       T00958                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sms  Candidatus Sulcia muelleri SMDSEM
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sms00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SMDSEM_192 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SMDSEM_192 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SMDSEM_192 (sucB)
Enzymes [BR:sms01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SMDSEM_192 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
202845..203954
Genome map
AA seq 369 aa AA seqDB search
MILEIKVPSPGESITEVEISSLLVNNGDFVKKNQVIAEIDSDKATLEICAEASGRLFFKA
KKGDTLKVGELLCIIDTSFLKKEENLLKEENFLKEEKKEENFLKEEKKEENFLILKKKNK
KNKFNRFFIVKKLTKLRQTISEKLVEVKNKTAMLTTFNEVDMRNILYLKNKYKFYFQEKH
GVKLGFMAFFVKSCIRALKNYPDINSMIDDKGKNKICFKYYDINIAVAGPKGLLVPVIRN
ADTLSFREIEKTIKNFSLKIKNSTISIDEMIGGTFTITNGGIFGSMLSTPIINPPQSAIL
GMHSIVERPIVKLGKIKVIPIMYLALSYDHRIIDGKEAVGFLFSIKESIENPIKFLIGSK
ENLNNFFEF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgattttagaaatcaaagttccttctccgggagaatcaataacagaagtagaaatttca
tcattgttagttaacaatggggattttgtaaaaaaaaatcaagtaattgctgaaatagat
tcagataaagctactttagaaatctgtgcagaagcaagtggaagattattttttaaagcc
aaaaaaggagacactttaaaagtaggagaattattatgtataatagatacttctttttta
aaaaaagaagagaatttattaaaagaagagaattttttaaaagaagaaaaaaaagaagag
aattttttaaaagaagaaaaaaaagaagagaatttcttaatcttaaaaaaaaagaataaa
aagaataaatttaatagattttttattgttaaaaaattaactaaacttagacaaacaatt
tcggaaaaacttgttgaagtaaaaaataaaacagctatgttgactacttttaatgaagta
gatatgagaaatattttatatttaaaaaataaatataaattttattttcaagaaaaacat
ggagtaaaattaggatttatggctttttttgtaaaatcttgtataagagcattaaaaaat
tatccagatattaattctatgatagatgataaaggaaaaaataaaatatgttttaaatat
tatgatataaatattgcagtagctggcccaaaaggattattagtcccagttattagaaat
gctgatactctttctttcagagaaatagaaaaaactataaaaaatttttctttaaaaata
aaaaattccactatttctatagacgaaatgattggaggaacttttactataacaaatgga
ggaatttttggatctatgttatctactccgataataaatcctcctcaaagtgctatatta
ggaatgcattctatagtagaaagacctatagtaaaattaggcaaaatcaaagttattcca
attatgtatttagcattatcttatgatcatagaattatagatgggaaagaagcagtggga
tttttattttcaataaaagaatcaatagaaaatcctattaaatttttaataggatccaaa
gaaaatttaaataatttttttgaattttaa

DBGET integrated database retrieval system