KEGG   Candidatus Sulcia muelleri SMDSEM: SMDSEM_266Help
Entry
SMDSEM_266        CDS       T00958                                 

Gene name
aceF
Definition
dihydrolipoamide acyltransferase E2 component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sms  Candidatus Sulcia muelleri SMDSEM
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:sms01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sms00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sms00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sms00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
263737..264867
Genome map
AA seq 376 aa AA seqDB search
MAEVIFMPRLSDTMEEGTVVKWHKKIGDKILEGDILAEIETDKAIQEFEAESNSTLLYIG
IKEGETAPVNSLLAILGSENEDISSLLKENQTIIKKNNKKIFISPLAKKIAFEKGISLEN
IKGSGNNGRIIKKDIEKYKNHLSDDKITFKKVKKVDHSNMRKIISKRLINSQMESPHYSL
FLEIKMDNLIKLRESLNEMNYLKKISFNDLIVKASAIAIKANPKINSSWTEKSILYHKNI
NIGIAVALEDGLIVPVIYNVDEKSLRKISLEIKEKVIKAKEKKLQSNELEGSTFTVSNLG
MFGIDSFTSIINQPNSCILSVGRIKKKPILNNDKIVIGHTTKFTLTCDHRMIDGAVGSDY
LKCLKHLLQEPLKILL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagttatatttatgcctcgtttaagcgatactatggaagaagggactgttgta
aaatggcataaaaagataggtgacaaaattttagaaggagatattttagctgaaatagaa
acggataaagcaattcaggaatttgaagctgaatctaattctacattactttatattggc
attaaagaaggagaaactgccccagtaaatagtttattagctattttagggtctgaaaat
gaagatattagttctttgttaaaagaaaaccaaactattattaaaaaaaataataaaaaa
atttttatttctcctttagctaaaaaaattgcttttgaaaaaggaatttcattagaaaat
attaaaggaagtggaaataatggacgtattataaaaaaagatatagaaaaatataagaat
catttatcagatgataaaataacttttaagaaagtaaagaaagtagaccattctaatatg
agaaaaataattagcaaaagattaattaattctcaaatggaatcccctcattattcttta
tttttagaaataaaaatggataatttaattaaattaagagaatctcttaacgaaatgaat
tatttaaaaaaaatatcttttaatgatttaatagttaaagcttcggctatagctataaaa
gcaaatccaaaaataaattcttcttggacagaaaaaagtatcttataccataagaatatt
aatataggaatagcagttgcattagaagatggattaattgttcctgtaatttataatgta
gatgagaaatcattaagaaaaatttctcttgaaataaaagagaaagtaataaaagctaaa
gaaaaaaaacttcaatctaatgaattagaaggtagtacttttactgtttcaaatcttgga
atgtttgggatagattcatttacatctattattaatcaacctaattcttgtattctttct
gtaggaaggataaagaaaaaacctattctaaataatgataaaattgtaataggtcatact
actaaatttacattaacatgtgatcatcgaatgatagatggtgcagtaggaagtgattat
ttaaaatgtttaaaacatttgttacaagaaccattaaagattttactttaa

DBGET integrated database retrieval system