KEGG   Candidatus Sulcia muelleri SMDSEM: SMDSEM_266Help
Entry
SMDSEM_266        CDS       T00958                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acyltransferase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sms  Candidatus Sulcia muelleri SMDSEM
Pathway
sms00010  Glycolysis / Gluconeogenesis
sms00020  Citrate cycle (TCA cycle)
sms00620  Pyruvate metabolism
sms01100  Metabolic pathways
sms01110  Biosynthesis of secondary metabolites
sms01120  Microbial metabolism in diverse environments
sms01130  Biosynthesis of antibiotics
sms01200  Carbon metabolism
Module
sms_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMDSEM_266 (aceF)
   00020 Citrate cycle (TCA cycle)
    SMDSEM_266 (aceF)
   00620 Pyruvate metabolism
    SMDSEM_266 (aceF)
Enzymes [BR:sms01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SMDSEM_266 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding eIF3_subunit DUF2118 Biotin_lipoyl_2 PYNP_C
Motif
Other DBs
NCBI-ProteinID: ACU52963
UniProt: C7LKK1
Position
263737..264867
Genome map
AA seq 376 aa AA seqDB search
MAEVIFMPRLSDTMEEGTVVKWHKKIGDKILEGDILAEIETDKAIQEFEAESNSTLLYIG
IKEGETAPVNSLLAILGSENEDISSLLKENQTIIKKNNKKIFISPLAKKIAFEKGISLEN
IKGSGNNGRIIKKDIEKYKNHLSDDKITFKKVKKVDHSNMRKIISKRLINSQMESPHYSL
FLEIKMDNLIKLRESLNEMNYLKKISFNDLIVKASAIAIKANPKINSSWTEKSILYHKNI
NIGIAVALEDGLIVPVIYNVDEKSLRKISLEIKEKVIKAKEKKLQSNELEGSTFTVSNLG
MFGIDSFTSIINQPNSCILSVGRIKKKPILNNDKIVIGHTTKFTLTCDHRMIDGAVGSDY
LKCLKHLLQEPLKILL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagttatatttatgcctcgtttaagcgatactatggaagaagggactgttgta
aaatggcataaaaagataggtgacaaaattttagaaggagatattttagctgaaatagaa
acggataaagcaattcaggaatttgaagctgaatctaattctacattactttatattggc
attaaagaaggagaaactgccccagtaaatagtttattagctattttagggtctgaaaat
gaagatattagttctttgttaaaagaaaaccaaactattattaaaaaaaataataaaaaa
atttttatttctcctttagctaaaaaaattgcttttgaaaaaggaatttcattagaaaat
attaaaggaagtggaaataatggacgtattataaaaaaagatatagaaaaatataagaat
catttatcagatgataaaataacttttaagaaagtaaagaaagtagaccattctaatatg
agaaaaataattagcaaaagattaattaattctcaaatggaatcccctcattattcttta
tttttagaaataaaaatggataatttaattaaattaagagaatctcttaacgaaatgaat
tatttaaaaaaaatatcttttaatgatttaatagttaaagcttcggctatagctataaaa
gcaaatccaaaaataaattcttcttggacagaaaaaagtatcttataccataagaatatt
aatataggaatagcagttgcattagaagatggattaattgttcctgtaatttataatgta
gatgagaaatcattaagaaaaatttctcttgaaataaaagagaaagtaataaaagctaaa
gaaaaaaaacttcaatctaatgaattagaaggtagtacttttactgtttcaaatcttgga
atgtttgggatagattcatttacatctattattaatcaacctaattcttgtattctttct
gtaggaaggataaagaaaaaacctattctaaataatgataaaattgtaataggtcatact
actaaatttacattaacatgtgatcatcgaatgatagatggtgcagtaggaagtgattat
ttaaaatgtttaaaacatttgttacaagaaccattaaagattttactttaa

DBGET integrated database retrieval system