KEGG   Stenotrophomonas maltophilia R551-3: Smal_0014Help
Entry
Smal_0014         CDS       T00733                                 

Definition
pyridoxine 5'-phosphate synthase
Orthology
K03474  
pyridoxine 5-phosphate synthase [EC:2.6.99.2]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
Vitamin B6 metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Smal_0014
Enzymes [BR:smt01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.99  Transferring other nitrogenous groups
    2.6.99.2  pyridoxine 5'-phosphate synthase
     Smal_0014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
15201..15944
Genome map
AA seq 247 aa AA seqDB search
MTQLSVNVNKIAVLRNSRGGAEPDVVRAAQACLDAGAHGITVHPRPDRRHITAEDVLALS
TLTRARGVEFNIEGNPFAPPREGYPGLLPLCAQTRPAQATLVPDSDGQITSDHGFDFERD
AERLRPLIAELKAMGCRVSLFVDAGNPLLEQAAEVGADRIELYTGPYAEAHAAGDAGAML
TLFATAARRAQAVGLGVNAGHDLSQDNLRDFLANVPDVLEVSIGHALIGEALYDGLDATV
RGYLALL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgacccagctcagcgtcaacgtcaacaagatcgccgtcctgcgcaattcgcgcggcggt
gccgaaccggacgtggtgcgtgcggcccaggcctgcctggatgccggcgcgcatggcatc
accgtgcacccgcggccggaccgccgccacatcaccgccgaggacgtgctggccctgtcc
acgctgacccgtgcgcgtggggtggagttcaacatcgaaggcaatccgttcgcaccaccg
cgcgagggttatccggggctgctgccgctgtgtgcacagacccgtccggcgcaggctacc
ctggtgccggacagcgacggccagatcacctccgatcatggcttcgacttcgagcgcgat
gccgagcgcctgcgcccgctgatcgccgaactgaaggcgatgggttgccgggtcagtctg
ttcgtcgacgccggcaacccgttgctggagcaggcggccgaggtcggtgccgaccgcatc
gagctgtacaccggcccctacgccgaagcgcatgcggcgggcgatgccggcgcgatgctg
acgctctttgccaccgctgcccgtcgagcgcaggccgtcggactgggcgtcaacgccgga
cacgacctgtcgcaggacaacctgcgtgatttcctggccaacgtgccggacgtgctggag
gtgtcgatcggccacgcgctgatcggtgaggccctgtacgacgggctggatgccacggtg
cgcgggtacttggcgctgctctga

DBGET integrated database retrieval system