KEGG   Stenotrophomonas maltophilia R551-3: Smal_0028Help
Entry
Smal_0028         CDS       T00733                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Smal_0028
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smal_0028
  Lipid metabolism
   00071 Fatty acid degradation
    Smal_0028
  Amino acid metabolism
   00350 Tyrosine metabolism
    Smal_0028
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Smal_0028
   00626 Naphthalene degradation
    Smal_0028
Enzymes [BR:smt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Smal_0028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(34147..35175)
Genome map
AA seq 342 aa AA seqDB search
MNSTMKAAVVREFGKPLVIEEVSVPRPGAGEVLVKIEACGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGHIVAVGGGVGHVKEGDRVGIPWLYSACGHCEHCLGGWETLCETQRNTGYSV
NGGFAEYALADANYVGLLPKEVGFVEIAPVLCAGVTVYKGLKVTDTKPGDWVVISGIGGL
GHMAVQYARAMGLNVAAVDVDDSKLALARQLGAQITVNARTTDPAAFLKKEIGGAHGALV
TAVSPKAFEQALGMVRRGGTVSLNGLPPGNFPLDIFGMVLNGITVRGSIVGTRLDLQESL
QFAAEGKVAATVSTDRLENINDVFARMHAGTIEGRVVLDFAA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgaccatgaaggccgccgtcgtacgtgagttcggcaagccactggtgatcgag
gaagtctcggtaccgcgcccgggggcgggcgaggtactggtcaagatcgaggcctgtggc
gtctgccacaccgacctgcacgccgccgagggcgactggccggtgaaaccgaacccgcca
ttcatccccggccacgagggcgtggggcacatcgtggccgtgggaggcggggtagggcac
gtcaaggaaggcgacagggtcggcatcccctggttgtactcggcgtgtggccattgcgaa
cactgcctgggtggctgggaaacgctgtgcgagacacagcgcaacaccggctactcggtc
aacggcggcttcgccgagtacgcactggccgatgccaactatgtcggcctgcttccgaag
gaagtgggcttcgtcgagatcgcgccggtgctgtgcgccggcgtgaccgtctacaaaggc
ctgaaggttaccgataccaagccaggggactgggtggtgatttccggcatcggtggcctc
ggccacatggcggtgcagtacgcccgcgcgatgggcctgaacgtggctgcggtggatgtg
gacgacagcaagctggcgttggcccggcagctcggcgcgcagatcaccgtcaacgcgcgc
accaccgaccccgccgccttcctgaagaaggaaatcggtggcgcgcacggtgcgctggtc
accgcggtttcgccgaaggcgttcgagcaggcactgggcatggtccgccgtggcggcacc
gtctcgctcaatggcctgccacccggcaatttcccgctggacatcttcggcatggtgctc
aacggcatcactgtgcgtggctcgatcgtcggcacccggctggacctgcaggaatcgctg
cagttcgccgccgaaggcaaggtcgcggccacggtcagcaccgaccgcctggagaacatc
aacgacgtgttcgcgcgcatgcacgcgggcaccatcgaaggccgcgtagtgctcgacttc
gccgcctga

DBGET integrated database retrieval system