KEGG   Stenotrophomonas maltophilia R551-3: Smal_0042Help
Entry
Smal_0042         CDS       T00733                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Smal_0042
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Smal_0042
Enzymes [BR:smt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Smal_0042
Lipid biosynthesis proteins [BR:smt01004]
 Desaturase
  First
   Smal_0042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
49601..50803
Genome map
AA seq 400 aa AA seqDB search
MPDALMSLLTGGVLGLGWWAMLAVLLVFTQITIFSVTLYLHRSQAHRGVDFHPALAHVFR
FWLWLTTSMITREWVAIHRKHHAKVETEDDPHSPVTRGIGKVFWHGVELYREARGQRADI
EQYGRGTPDDAIERRLYTPHATLGPVLLFAINTVLFGLPGVALWAIQMAWIPFWAAGVVN
GLGHWWGYRNYESADTSTNLTPWGFWIGGEELHNNHHAFPSSARFAMRRWEFDIGWSAIR
LLQALRLAKVLRVVPAMDVRPNIAVPDAETLKALLSHRFQAMTDYQRNVFMPALREEAVQ
AGAKLRRLLPRRLRRGLVNDGRWLKPDSRAQLSEWVAQRPRIRTLVEYRGRLAALLEARG
HDAAERLHQLQAWCREAEESGIAALQAYAARLKGYSLVGA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgccagatgccctgatgtcactgttgaccggtggtgtgctcggcctgggctggtgggcc
atgctggcggtgctgctggtcttcacccagatcaccatcttctcggtgaccttgtacctg
caccgcagccaggctcatcgcggggtcgatttccacccggcgctggcccatgtgttccgc
ttctggctgtggctgaccacctcgatgatcacccgcgagtgggtggccatccaccgcaag
caccacgcgaaggtggaaaccgaggacgacccgcacagcccggtcacccgcggcatcggc
aaggtgttctggcacggcgtggagctgtaccgcgaagcccgcggccagcgcgcggacatc
gagcagtacgggcgcggcaccccggatgatgcgatcgagcgccgcctgtataccccgcat
gccacgttggggccggtgctgctgttcgcgatcaacacggtgttgtttggcctgccgggc
gtggccctgtgggcgatccagatggcgtggattccgttctgggcggccggcgtggtcaat
ggcctgggccactggtggggctaccgcaactacgagtcggccgatacctccaccaacctc
acgccgtgggggttctggatcggtggcgaggagctgcacaacaatcaccacgccttcccc
agctcggcgcgcttcgcgatgcggcgctgggagttcgatatcggctggagtgcgatccgc
ctgctgcaggcgctgcgcctggccaaggtgctgcgggtggtgccggccatggacgtgcgc
ccgaacatcgcggtgcccgatgccgaaaccctgaaggcgctgctgtcgcaccgcttccag
gcgatgaccgattaccagcgcaatgtgttcatgccggctctgcgcgaggaagccgtgcag
gctggggccaagctgcgccgcctgctgccgcgccggctgcgccgtggcctggtcaacgat
ggccgctggctgaagccggacagtcgtgcccagctcagcgaatgggtggcgcagcgcccg
cgcatccgcacactggtcgagtaccgcgggcgcctggccgcattgctggaagcccgcggc
cacgatgcggccgagcggctgcaccagctgcaggcgtggtgccgcgaggccgaggaaagc
ggtatcgccgcgctgcaggcgtatgccgcgcgattgaagggctacagcctggtgggcgcg
tga

DBGET integrated database retrieval system