KEGG   Stenotrophomonas maltophilia R551-3: Smal_0157Help
Entry
Smal_0157         CDS       T00733                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Smal_0157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 PepSY_2
Motif
Other DBs
NCBI-ProteinID: ACF49862
JGI: Smal0157
UniProt: B4SSI0
Position
complement(198153..198554)
Genome map
AA seq 133 aa AA seqDB search
MRAACLLIAVVVALAATACQRPPPAPATPEQARQQAMQRAFELCAGCHTVQPGGIHRFGP
NLHGVIGRRAGSLPDYGYSDGMRRADITWSAQTLDAFLQSPTHVVPGTRMYNAFPSAERR
ALVIAYLQQQSPQ
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctgcctgcctgctcatcgccgtcgtcgtggcccttgcggccacggcctgccag
cgcccgccgccagcccccgccacgcccgaacaggcgcgccagcaggccatgcagcgcgcg
tttgaactgtgtgcgggttgccacaccgtacaacccggcggcatccatcgcttcggaccg
aacctgcatggagtgatcggtcgccgtgccggcagcctgcccgattacggctactccgac
ggcatgcgccgcgccgacatcacctggagcgcgcagaccctggatgccttcctgcagtcg
cccacccacgtggtgccgggtacacgcatgtacaacgccttccccagtgccgaacgccgt
gcgctggtgatcgcctacctgcagcagcagtcgcctcagtga

DBGET integrated database retrieval system