KEGG   Stenotrophomonas maltophilia R551-3: Smal_0157Help
Entry
Smal_0157         CDS       T00733                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Smal_0157
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Smal_0157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(198153..198554)
Genome map
AA seq 133 aa AA seqDB search
MRAACLLIAVVVALAATACQRPPPAPATPEQARQQAMQRAFELCAGCHTVQPGGIHRFGP
NLHGVIGRRAGSLPDYGYSDGMRRADITWSAQTLDAFLQSPTHVVPGTRMYNAFPSAERR
ALVIAYLQQQSPQ
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctgcctgcctgctcatcgccgtcgtcgtggcccttgcggccacggcctgccag
cgcccgccgccagcccccgccacgcccgaacaggcgcgccagcaggccatgcagcgcgcg
tttgaactgtgtgcgggttgccacaccgtacaacccggcggcatccatcgcttcggaccg
aacctgcatggagtgatcggtcgccgtgccggcagcctgcccgattacggctactccgac
ggcatgcgccgcgccgacatcacctggagcgcgcagaccctggatgccttcctgcagtcg
cccacccacgtggtgccgggtacacgcatgtacaacgccttccccagtgccgaacgccgt
gcgctggtgatcgcctacctgcagcagcagtcgcctcagtga

DBGET integrated database retrieval system