KEGG   Stenotrophomonas maltophilia R551-3: Smal_0188Help
Entry
Smal_0188         CDS       T00733                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smal_0188
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Smal_0188
   00630 Glyoxylate and dicarboxylate metabolism
    Smal_0188
Enzymes [BR:smt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Smal_0188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
229356..230993
Genome map
AA seq 545 aa AA seqDB search
MPAVASAVPTPAAKATPGIALATRVAGQDTLLPAPLLALLVSLHRAVEPGRQARLQARRV
RQAFFDQGGLPDFREDTTAIRSGDWRVAPLPAALQDRRVEITGPTDPKMVINALNSGAKV
FMADFEDSTSPTWRNLLAGQQSLAAAVRGDLEYTAPASNGKAGKHYTLRPFDEQAVLIVR
PRGWHLDEKHVRIDGQFIAGGLFDAAVFAFHNARTLQAKDRGPYFYLPKLQSMEEAALWE
TALSHIEGMLGLPHGQIKVTVLIETLPAVFEMDEILHALRDRIVGLNCGRWDYIFSYLKT
FRRHADRVLPERGQVTMTQPFLKAYSELLIQTCHRRGAHAMGGMAAQIPINNDAAANEQA
MARVRADKLREVTAGHDGTWVAHPALIPVAMAIFDEHMPGANQHSVLRQDVRVGRDELIA
RPPGTITRAGFEGNVEVCVRYLAAWLDGNGCVPIHHLMEDAATAEISRSQLWQWLHTPGQ
QLDDGTAIDLALLDSTLSQLPARLGDTAALPGGTHIGEAIALLGELSRSDELTDFLTLPA
YARID
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctgtcgcttccgctgttcccacccccgccgccaaggccactcccggtatcgcc
ctggcgacccgcgtggccggccaggacaccctgctgccggcgccgctgctggccctgctg
gtgtcgctgcaccgcgcggtggaaccgggccggcaggcacggctgcaggcgcgccgcgtg
cgccaggcgttcttcgaccagggcggcctgccggacttccgcgaagacaccaccgcgatc
cgcagcggcgactggcgtgttgccccgctgccggccgcgctgcaggaccgccgcgtcgag
atcaccggcccgaccgacccgaagatggtcatcaacgcgctgaactccggcgccaaggtg
ttcatggccgacttcgaggattcgacctcgccgacctggcgcaacctgctggccgggcag
cagtcgctggccgccgcggtgcgtggcgatctcgagtacaccgcaccggcatccaacggg
aaggccggcaagcactacaccttgcgcccgttcgacgaacaggcggtgctgatcgtacgc
ccgcgcggctggcacctggacgagaagcacgtgcgcatcgatggccagttcatcgctggt
ggcctgttcgacgcggcggtgttcgccttccacaacgcccgcaccctgcaggccaaggat
cgcggcccgtacttctacctgcccaagctgcagagcatggaagaggcggcgctgtgggag
accgcgctgtcgcacatcgaaggcatgctcggcctgccgcacggccagatcaaggtgacc
gtgctgatcgaaacgctgccggcggtgttcgagatggacgagatcctgcacgcgctgcgt
gaccgcatcgtcggcctgaactgcgggcgctgggactacattttttcgtacctgaagacc
ttccgccgccatgccgaccgcgtgctgcccgaacgcggccaggtgaccatgacccagccg
ttcctgaaggcgtattcggagctgttgatccagacctgccatcgccgcggtgcgcatgcg
atgggcggcatggctgcgcagattcccatcaacaacgatgccgctgccaacgagcaggcg
atggcccgcgtgcgtgctgacaagctgcgcgaggtcactgccggccacgacggtacctgg
gtggcgcacccggcgctgattccggtggcgatggcgatcttcgacgaacacatgcccggt
gcaaaccagcacagcgtgctgcgccaggatgtgcgcgtcggccgcgacgaactgatcgcg
cggccgccgggcaccatcacccgtgccggctttgagggcaacgtggaagtctgtgtgcgc
tacctggcggcgtggctggatggcaacggctgcgtgccgatccatcacctgatggaggac
gcggccaccgccgagatcagccgcagccagctgtggcagtggctgcatacgccgggccag
cagctggacgatggcactgcgatcgatctggcgctgctggattccaccctgtcgcagctg
ccggcacggctgggcgataccgccgcgctgcccggtggcacacacatcggcgaggccatc
gcgctgctcggcgaactgagccgcagcgacgaactgaccgatttcctgaccctgccggcc
tacgcgcgcatcgactga

DBGET integrated database retrieval system