KEGG   Stenotrophomonas maltophilia R551-3: Smal_0189Help
Entry
Smal_0189         CDS       T00733                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smal_0189
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Smal_0189
Enzymes [BR:smt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Smal_0189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
231058..232359
Genome map
AA seq 433 aa AA seqDB search
MSKLPTAEQIQHDWDTNPRWEGIQRNYSAADVVRLRGTVHIEHSLARLGAEKLWASLHER
EFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPADSVPAVVKR
INNTLLRADQLHHAEGKDDIDFLQPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFEDQ
LASVKKCGHMGGKVLVPTREAIEKLNAARLAADVLGVPTLLVARTDAEAADLLTSDIDGN
DKPFATGERTVEGFYKTRNGLDQAISRGLAYAPYADLVWCETGKPDLEFARKFAEAIHAK
FPGKLLAYNCSPSFNWKKNLDDATIAKFQKELGSYGYKFQFITLAGFHALNYGMFNLAHG
YARRQMSAFVELQEAEFEAAERGFTAVKHQREVGTGYFDAVTQAIQQGQSSTTALTGSTE
EEQFHGGRSERAA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagctgcccactgccgaacagatccagcacgactgggacaccaacccgcgttgg
gaaggcatccagcgcaactacagcgctgccgacgtggtgcgcctgcgcggcaccgtccac
atcgagcactcgctggcccgcctgggtgcagagaagctgtgggcatcgctgcacgagcgc
gagttcgtcaacgcgctgggtgcactgaccggcaaccaggccatgcagcaggtcaaggcc
gggctgaaggcgatctacctgtccggctggcaggtggcggccgacgccaacctggccggg
cagatgtacccggaccagtcgctgtacccggccgattcggtgccggcggtggtcaagcgc
atcaacaacaccctgctgcgcgccgaccagctgcaccacgccgaaggcaaggacgacatc
gatttcctgcagccgatcgtggccgatgccgaagccggcttcggcggcgtgctcaacgcg
ttcgagctgatgaaggcaatgatcgaggccggtgccgctggcgtgcacttcgaagaccag
ctggcgtcggtgaagaagtgcggccacatgggcggcaaggtgctggtgccgacccgcgag
gcgatcgagaagctcaacgccgcgcgcctggccgccgacgtgctgggcgtgccgaccctg
ctggtggcgcgtaccgatgccgaagccgcggatctgctgaccagcgacatcgatggcaac
gacaagccgttcgccaccggtgagcgcaccgtggaaggcttctacaagacccgcaatggc
ctggaccaggcgatcagccgcggcctggcctatgcgccctatgccgacctggtgtggtgc
gagaccggcaagccggacctggaattcgcacgcaagttcgccgaggcgatccatgcgaag
ttccccggcaagctgctggcctataactgctcgcccagcttcaactggaagaagaacctg
gacgacgccaccatcgccaagttccagaaggagctgggcagctacggctacaagttccag
ttcatcaccctggccggcttccatgcgctgaactacggcatgttcaatctggcccacggc
tatgcacgtcgacagatgagcgcgttcgtggaactgcaggaagccgagtttgaagcggcc
gagcgcggcttcactgcggtcaagcatcagcgtgaggttggcaccggctacttcgatgcg
gtgacccaggcgatccagcagggccagtcgtcgaccaccgcattgaccggttcgaccgag
gaagagcagttccacggcgggcgcagcgaacgcgcggcgtga

DBGET integrated database retrieval system