KEGG   Stenotrophomonas maltophilia R551-3: Smal_0286Help
Entry
Smal_0286         CDS       T00733                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:smt00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:smt00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:smt00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:smt00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:smt00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:smt00520]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:smt00230]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:smt00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
333774..336122
Genome map
AA seq 782 aa AA seqDB search
MSGIGEGQRGRSLGRSAPLLGVLLILLAGWFGWSAVQQWRQEANGQALEEARDQAVQGLQ
DAAAGQLKQLQQQLKNERVQQALQAGDAAAAALAVRESWTGVEQAEVLSADLASAYADPA
TFGYARLALLEAALAEAKPSLRVVRDGGGNRLGLAAPVQLGSLGPAVLYVRQPLLRLTAP
LDQVSAPATGFLGLRQGMHDLVTQGDASLAESAEALARPIPGTPLRLVAAVPNVESGPLG
LGALASAIVALLLAFIAVLLVIGRGRLPKTLPLPRRAAAADADHGPTLSESLQQAPPAVA
AVTSSGDATPPSPPPVPAEALAAGIFRAYDIRGVVGSELTPKTAALIGQAIGTVALEQGL
REVVIGRDGRLSGQELAAGLAEGLRRAGCAVIDIGLAPTPLVYYAAFHLRTGTCVAVTGS
HNPPEYNGFKVVIGGETLSGDAITDLYQRIVEGRLVQAAEPGDYQQRDVAADYIQRIADD
VQLDRPLKVVADAGNGVAGALAPQLLEAIGAEVIPLYCDVDGTFPNHHPDPSEPANLEDL
VQTVKRFGADLGVAFDGDGDRLGVVTAEGKIIYADRLLMLFAADVLMRNPGAMVIYDVKC
TGKLSDHVLRNGGSPLMWKTGHSLMKAKMRETDAELAGEMSGHFFFKERWFGFDDGLYAA
ARLLEILAQREETPDEVLAELPEMVATPELKVPVAEGTPHALVAMLVAAAQSPDNPYVGG
RLSTIDGLRVDFPDGWGLVRASNTTPVLVLRFEGNDEAALERIQALFRSQLQPVLGDTPL
GF
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcatcggggaaggacagcggggacggtcgttgggtcgcagtgcaccactactg
ggggtgctgctgatcctgctggccggctggttcggatggagcgcggtgcagcaatggcgc
caggaggccaacggccaggcgctggaagaagcacgtgaccaggccgtgcagggcctgcag
gacgcggccgccggccagctgaagcagctgcagcagcagctgaagaacgagcgcgtgcag
caggcgctgcaggccggcgatgccgctgcagcggcactggccgtgcgcgagagctggacc
ggcgtggaacaggcggaagtgctgagcgccgatctggccagcgcctacgccgacccggcc
accttcggctatgcccggctggcgctgctggaagcggcattggctgaagccaagcccagc
ctgcgcgtggtccgcgatggcggtggcaaccgcctgggtctggccgcgccggtacagctg
ggcagccttgggccggcggtgctctatgtgcgccagccgttgctgcggctgaccgcgccg
ttggaccaggtcagtgcgccggccacgggtttcctcggcctgcgccagggtatgcatgat
ctggtcacccagggcgatgccagcctggccgagagcgccgaggcactggcacggccgatc
ccgggcacgccgttgcgcctggtggccgcggtccccaatgtcgaatccgggccgttgggc
ctgggcgcgctggccagcgccatcgtcgcgctgctgctggcgttcatcgcggtgctgctg
gtgatcggccgtggccgcctgccaaagaccctgccgctgccacgtcgcgccgctgcggcg
gatgccgaccatggccccaccctgagtgaaagcctgcagcaggctccgccagcggtggcc
gccgtgaccagcagtggcgatgccacgccaccgtcgccaccgccggtgccggccgaggcg
ttggccgccggcatcttccgcgcctatgacatccgtggcgtggtcggcagcgaactgacg
ccgaagactgcggcgctgatcggccaggccatcggcaccgtggccctggaacagggcctg
cgcgaggtggtgatcggccgcgatggccgcctgtccggtcaggagctggccgccggcctg
gccgaaggcctgcgccgtgccggctgtgcagtcatcgacatcggcctggcgccgaccccg
ctggtgtattacgccgccttccatctgcgcacggggacctgcgtggctgtgaccggcagc
cacaatccgccggagtacaacgggttcaaggtggtcatcggcggtgaaacgctgtccggt
gatgcgatcaccgatctttaccagcgcattgtcgagggccgcctggtacaggccgccgaa
ccgggcgactaccagcagcgggacgttgcggccgactacatccagcgcatcgccgatgac
gtgcagctggaccgcccgctgaaagtggtggccgatgccggcaacggcgtcgccggcgcg
ctcgcaccccagctgctggaagcgatcggcgctgaggtcattccgctgtactgcgatgtc
gacggcaccttccccaaccatcatcccgacccgagcgaaccggccaacctggaagacctg
gtgcagacggtgaagcgcttcggtgccgatctcggcgtggccttcgatggcgacggcgac
cgtctgggcgtggtgaccgccgaaggcaaaatcatctacgccgatcgcctgctgatgctg
ttcgccgccgatgtgctgatgcgcaatccgggcgcaatggtgatctacgacgtgaagtgc
accggcaagctgtccgaccacgtgctgcgcaacggtggcagtccgctgatgtggaagacc
gggcattcgctgatgaaggcgaagatgcgcgagaccgatgccgaactggccggcgagatg
agtggccacttcttcttcaaggagcgctggttcggtttcgatgacggcctgtatgcggcc
gcgcgcctgctggagattctggcccagcgcgaggaaacgccggatgaggtgttggccgag
ctgccggagatggtggccacgccggaactgaaggtgccggtggccgaaggcacgccgcat
gcgctggtggcgatgctggtggcggcggcgcagtcgcccgacaacccgtatgtgggcggt
cggctgtcgaccatcgatggcctgcgcgtggacttccccgatggctggggcctggtgcgc
gcctccaacaccacgccggtgctggtgctgcgtttcgaaggcaacgacgaggcggcactg
gaacgaatccaggcgctgttccgcagccagctgcaaccggtgctgggcgacaccccgctg
ggcttctga

DBGET integrated database retrieval system