KEGG   Stenotrophomonas maltophilia R551-3: Smal_0505Help
Entry
Smal_0505         CDS       T00733                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:smt00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:smt00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
594460..595017
Genome map
AA seq 185 aa AA seqDB search
MKVIETRLPGCVVIEPAVFGDARGYFFETWNAERFAALGLPHRFAQSNVSTSAQGVLRGL
HYQWPRPQGKLVSVLEGEVYDVAVDIRRGSPTFGQWEAVVLSAENKKQFWIPDGFAHGFA
VLSERAVFSYLCTEVYLKDFDAGVRWNDADIAVDWPISAPTLSAKDESAPFLKDIAEDRL
PVYVP
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtgattgaaaccaggttgcccggctgcgtagtgatcgagccggccgtgtttggt
gatgcccgtggttacttcttcgaaacctggaatgccgagcgcttcgccgcgctgggcctc
ccgcatcgcttcgcacagagcaatgtttccacctcggcgcagggagtgctgcgcggcctg
cattatcagtggccgcgcccgcagggcaagttggtgagcgtgctggaaggggaggtctat
gatgtcgctgtagatatccgccgtggctcgccgaccttcggccagtgggaagcggtagtg
ctgagcgccgagaacaagaagcagttctggattccggatggcttcgcgcacggctttgcg
gtgctgtccgaacgcgcggtgttcagttacctgtgcaccgaggtgtacctcaaggacttc
gatgccggcgtgcgctggaacgatgcggacatcgccgtggactggccgatcagtgcaccg
acgctgtcggccaaggatgagagtgctcccttcctgaaggacatcgctgaagaccgcctg
ccggtctacgtgccatga

DBGET integrated database retrieval system