KEGG   Stenotrophomonas maltophilia R551-3: Smal_0509Help
Entry
Smal_0509         CDS       T00733                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
smt00010  Glycolysis / Gluconeogenesis
smt00030  Pentose phosphate pathway
smt00051  Fructose and mannose metabolism
smt00052  Galactose metabolism
smt00230  Purine metabolism
smt00500  Starch and sucrose metabolism
smt00520  Amino sugar and nucleotide sugar metabolism
smt00521  Streptomycin biosynthesis
smt01100  Metabolic pathways
smt01110  Biosynthesis of secondary metabolites
smt01120  Microbial metabolism in diverse environments
smt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smal_0509
   00030 Pentose phosphate pathway
    Smal_0509
   00051 Fructose and mannose metabolism
    Smal_0509
   00052 Galactose metabolism
    Smal_0509
   00500 Starch and sucrose metabolism
    Smal_0509
   00520 Amino sugar and nucleotide sugar metabolism
    Smal_0509
  Nucleotide metabolism
   00230 Purine metabolism
    Smal_0509
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Smal_0509
Enzymes [BR:smt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Smal_0509
    5.4.2.8  phosphomannomutase
     Smal_0509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ACF50214
JGI: Smal0509
UniProt: B4SJ46
Position
complement(599417..600763)
Genome map
AA seq 448 aa AA seqDB search
MPLPAFKAYDIRGRVPEELNEDLARRIGVALAAQLAPGPVVLGHDVRLTSAGLQDALAAG
LRGTGREVIDIGLCGTEEVYFQTDHLGAAGGVMVTASHNPMDYNGMKLVKENARPISSDT
GLFAISDAVAGDTSEAQPPRAGQVAQHDKSAYIQHLLSYVDTSRLKPLKLVVNAGNGGAG
AIVDLLAPHLPFEFIRICHEPDGSFPNGIPNPLLPENRAATADAVREHGADFGIAWDGDF
DRCFFFDHSGRFIEGYYLVGLLAKAILARNPGGKIVHDPRLVWNTVDMVEQAGGVPVQCK
SGHAFIKEKMRAEDAVYGGEMSAHHYFREFAYADSGMIPWLLIAQLVSESGRSLADWVED
RMAAYPCSGEINFKVDDAKAAVARVMEHFAAQSPALDHTDGISADFGDWRFNLRSSNTEP
LLRLNVEARGDAALMQARTDEISRLIQQ
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgcccgccttcaaggcctacgatatccgtggccgcgtgcccgaggaactgaac
gaagacctggcccgccgcatcggcgtcgccctggccgcgcagctcgctcccggcccggtg
gtgcttggccatgatgtgcgtctgaccagcgcaggcttgcaggacgcgttggcggccggc
ctgcgcggcaccggccgcgaggtgatcgacatcggcctctgcggtaccgaggaagtctat
ttccagaccgaccacctgggtgcggccggcggcgtgatggtcaccgccagccacaacccg
atggattacaacggcatgaagctggtcaaggagaacgcgcggccgatcagctcggatacc
ggcctgttcgcgatttccgatgcggtcgccggcgacacctccgaggcccagccgcctcgc
gcgggccaagtcgcccagcatgacaagagtgcctatatccagcacctgctcagctatgtc
gataccagcaggctcaagccgctgaagctggtggtcaatgccggcaacggcggtgctggt
gccatcgtcgacctgctggcaccgcacctgccgttcgagttcatccgcatctgccatgaa
cccgatggcagcttccccaacggtattcccaacccgctgctgccggaaaaccgcgccgcc
accgccgatgcggtgcgcgaacacggcgcagacttcggcattgcctgggacggtgacttc
gaccgctgcttcttcttcgatcattccggccgcttcatcgagggctactacctggtcggc
ctgctggccaaggcgatcctggcgcgcaatccgggcggcaagatcgtgcatgatccacgc
ttggtctggaacaccgtggacatggtcgagcaggccggtggcgtgcccgttcagtgcaag
agtggccacgccttcatcaaggaaaagatgcgtgccgaagatgcggtgtacggcggcgag
atgagcgcccaccattacttccgcgagttcgcctatgccgactccgggatgatcccgtgg
ctgctgatcgcgcagctggtttccgaaagtggtcgttcgctggccgactgggttgaagac
cgcatggccgcctatccctgcagcggcgagatcaatttcaaggtggacgatgccaaggcc
gccgtcgcgcgcgtgatggagcacttcgcggcgcagtcgcccgcgctggaccacaccgac
ggcatcagcgccgatttcggcgactggcgcttcaacctgcgcagttccaacaccgaacca
ctgctgcgcctgaacgtcgaagcgcgcggtgacgctgcgttgatgcaggcgcgcaccgac
gaaatttcccgtctgatccagcagtaa

DBGET integrated database retrieval system