KEGG   Stenotrophomonas maltophilia R551-3: Smal_0541Help
Entry
Smal_0541         CDS       T00733                                 

Definition
protein disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
smt  Stenotrophomonas maltophilia R551-3
Brite
Enzymes [BR:smt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Smal_0541
Secretion system [BR:smt02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Smal_0541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
633424..634215
Genome map
AA seq 263 aa AA seqDB search
MLRFAIAAVFGALSLTACAQPAPPAAKAPATAAAAKAASPAANGSADQAVRAALTALNPG
FEVDYIGAAPFPGFREVVVSGQLLYVSDDGRYLFQSQPYDTRAKGPANSEGLLGYRRDLL
AKANHGDRIVFAAPNAKYTISVFTDIECGYCRKLHQDIAELNRNGISVEYLAFPRMGLGS
KDYTDMISVWCAADRRQALTSAKRGGSVPAKSCTNPVAMQYALGQQLGVNGTPAIFAPDG
TQLGGYLPPAQLRAALEKLSAKR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgctccgatttgccatcgccgccgtgttcggtgcgctcagcctgactgcctgcgcccag
ccggccccgccggccgccaaggcacctgctaccgctgctgcggccaaggctgccagcccg
gctgccaacggctcggccgaccaggccgtgcgtgccgcgctgaccgcgctcaatccgggt
ttcgaagtggattacatcggcgccgcgccgttccccggcttccgcgaagtggtggtctcc
ggccagctgctgtacgtgtccgatgacggtcgctacctgttccagtcgcagccctacgac
acccgcgccaagggtccggccaacagcgaaggcctgctcggctaccgccgcgatctgctg
gccaaggccaaccacggtgaccgcatcgtgttcgctgcgcccaatgccaagtacaccatc
agcgtgttcaccgacatcgaatgcggctactgccgcaagctgcaccaggatatcgccgag
ctcaaccgcaacggcatcagtgtcgagtacctcgcgttcccgcgcatgggcctgggcagc
aaggactacaccgacatgatctcggtctggtgtgcggccgatcgtcgccaggcgctgacc
agcgccaagcgcggtggcagcgtgccggcgaagagctgcaccaacccggtggcgatgcag
tacgcactgggccagcagctgggcgtgaacggtaccccggcgatcttcgccccggacggt
acccagctgggcggctacctgccgccggcgcagctgcgcgccgcgttggaaaagctgtcg
gccaagcgctga

DBGET integrated database retrieval system