KEGG   Stenotrophomonas maltophilia R551-3: Smal_0641Help
Entry
Smal_0641         CDS       T00733                                 

Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Smal_0641
Enzymes [BR:smt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Smal_0641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(759769..760734)
Genome map
AA seq 321 aa AA seqDB search
MSSSVVVVGSFNVDHVWRCESLPAPGATIAGRYSTGPGGKGFNQAVAACRAGADTHFVCA
LGDDAGGATARELAAQDGFGLIAEASSEPTGTAGIYVDARGRNTIVIGPGANAALSTDFL
QQQHALLAGAKVVLVQLESPVQTIEAALATAREAGVTTVLNTAPADAPSTIGLLKLADVI
TPNETEFAALLGRHVGERVDANDVAALDGASLHALCRKLVGNGTVVVTLGSVGVFVSHAD
ENLRGDTQPYYRVGAEQVQAIDTTGAGDAFNGALAASLAQVADAPFARHVRFANQFAGRS
TEKEGAAAAMPRFTPADSEAK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcagtgtcgttgtcgtcggttccttcaatgtcgatcacgtgtggcggtgcgag
tcgctgccggcaccgggtgcgaccattgccggccgctacagcaccggccccggtggcaag
ggcttcaaccaggccgtggcggcctgccgcgccggtgccgacacgcacttcgtgtgcgcg
ttgggcgatgacgccggtggcgccaccgcccgcgagctggccgcacaggatggcttcggg
ctgatcgccgaagccagcagcgaaccgactggcaccgctggtatctacgtggatgcccgt
ggccgcaacaccatcgtgatcggcccgggtgccaacgccgcactgagcaccgacttcctg
caacagcagcacgcgctgctggccggcgccaaggtggtgctggtgcagctggaatcgccg
gtacagaccatcgaagcagcgctggccacggcccgcgaagccggcgtcaccacggtgctc
aacaccgcaccggccgacgctccctcgaccatcggcctgctcaagctggccgatgtgatc
accccgaacgagaccgagttcgccgccctgctcggccgccatgtcggtgagcgcgtggat
gccaacgacgtcgccgcgctggatggcgccagcctgcatgcgctgtgccgcaagctggtc
ggcaacggtacggtggtggtgaccctgggttcggtgggcgtgttcgtgtcgcatgccgac
gagaacctgcgcggcgatacccagccgtactaccgcgtgggtgccgaacaggtgcaggcg
atcgacaccaccggtgccggtgacgccttcaatggcgcgctggccgcgtcgctggcgcag
gtggccgatgccccgttcgcccgccacgtgcgcttcgccaaccagttcgccggtcgctcg
accgagaaggaaggcgctgctgcggcgatgccgcgcttcaccccggctgattccgaagca
aagtag

DBGET integrated database retrieval system