KEGG   Stenotrophomonas maltophilia R551-3: Smal_0651Help
Entry
Smal_0651         CDS       T00733                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Smal_0651
Enzymes [BR:smt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Smal_0651
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Smal_0651
Lipid biosynthesis proteins [BR:smt01004]
 Fatty acid synthase
  Component type
   Smal_0651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
771647..772291
Genome map
AA seq 214 aa AA seqDB search
MRKTGWSRRAGAMMVLLLGLLLLPGLASAKGPAGTVLVLGDSLSAAHNIPADAGWVSLLQ
QRVRQQSKTPARIVNASMSGETTAGALTRLPGLLAKEKPTVVVIALGGNDALRGLTPAQV
QGNLEKMVQASQKAGAKVLLLGIDVPPNYGAGYRQRLAAAYKALATQYKVPLLPFLLEGV
ALQPGLMQADGLHPTAQAQPKVLDNVWPLLRPLL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagacgggatggagccggcgagccggcgcgatgatggtgctgttgctggggtta
ctgctgctgcccgggctggcctctgccaaaggtccggccggcacggtgctggtgctcggc
gacagcctcagtgctgcccacaatatccctgccgacgccggctgggtcagcctgctgcag
cagcgggtcaggcagcagtcgaaaaccccggcgcgcatcgtcaatgccagcatgagcggt
gagaccaccgccggcgctctgacccgcctgccgggcctgctggccaaggagaaaccgact
gtggtggtgattgccctcggcggcaatgacgcactgcgcgggctgaccccggcgcaggtg
cagggcaacctggaaaagatggtgcaggccagccagaaggctggtgccaaggtgctgctg
ctgggcatcgatgtaccacccaactatggggcgggttatcgccagcggctggcggcggcc
tacaaggcactggccacgcagtacaaggtgccgctgctgccgttcctgctggaaggtgtg
gcactgcagcccgggctgatgcaggctgatggcctgcacccgaccgcgcaggcgcagccg
aaggtgctggacaacgtctggccattgctgcggcccctgctctga

DBGET integrated database retrieval system