KEGG   Stenotrophomonas maltophilia R551-3: Smal_0664Help
Entry
Smal_0664         CDS       T00733                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Smal_0664
   00670 One carbon pool by folate
    Smal_0664
Enzymes [BR:smt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Smal_0664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
783054..783545
Genome map
AA seq 163 aa AA seqDB search
MKLSMIVALDRNRGIGQGNAMPWHLPDDFKHFKALTLGKPILMGRKTAESIGRVLPGRTN
LVLTRSGQVPFEGMRAVASLDEAKAIAEGEGASELCIIGGGEIFHQLLDQASDLYLTWVD
AEVPADTHFPEVDADDWQEVSSEPHPADERHAYAFRFVHYVRR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtcgatgatcgtggcgctggaccgcaatcgtggcatcggccagggcaatgcc
atgccctggcacctgccggatgatttcaagcatttcaaggcgctcaccctgggcaagccg
atcctgatggggcgcaagaccgccgagtcgatcggccgcgtgctgccggggcggaccaac
ctggtgctgacccgcagcggccaggtgccattcgagggcatgcgcgcggtggcgtcactg
gacgaggcgaaggcgattgccgaaggcgagggcgccagcgaactgtgcatcatcggcggc
ggcgagatcttccaccagctgctggaccaggccagcgacctgtacctgacctgggtcgat
gcagaagtccccgccgacacgcatttccctgaggtggacgcggatgactggcaggaagtg
agcagcgagccgcacccggccgatgaacgccacgcctacgcgttccgcttcgtgcactac
gtgcgccgctga

DBGET integrated database retrieval system