KEGG   Stenotrophomonas maltophilia R551-3: Smal_1188Help
Entry
Smal_1188         CDS       T00733                                 

Definition
alpha/beta hydrolase fold domain-containing protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
smt  Stenotrophomonas maltophilia R551-3
Brite
Enzymes [BR:smt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Smal_1188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1347302..1348138)
Genome map
AA seq 278 aa AA seqDB search
MTETHDFFLPGGPQGVLLVHGLTGTPAEMRMLGKGLNNAGFTVHGVQLPGHCGSVDDLLA
TTWEQWYQGVEDAAAALRGKVDQLFVGGLSMGAVLSLALAARRPEWVSGVGVYGATFRYD
GWNIPAVARFSFLLPWFKRFNIGRDRMFMEEPPYGLRDERLRAQVSAAMLSGDSAAAGLP
GNPWHALAEMRALSNWTRRHLHQVTAPCLVMHAREDDVASMGNAELVMSRVSGPKELVVL
EDSYHMITIDRERRDVIRRSARFFSEIGERSGILKAVA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaaacgcacgacttcttcctccccggtggcccgcagggcgtgctgctggttcac
ggcctgaccggcacgccagcggaaatgcgcatgctgggcaagggcctgaacaatgccggt
ttcaccgtgcacggtgtgcagctgcccggccattgcggcagcgtcgacgacctgctggcg
accacctgggaacagtggtaccagggcgtggaagatgcggcagcggccttgcgcggcaag
gttgaccagctgttcgtcggcggcctgtcgatgggcgcggtactgtcgctggcattggct
gcgcgccgcccggaatgggtttccggcgtgggcgtatacggcgccacgttccgctacgac
ggttggaacattccggccgtggcccgcttctcgttcctgctgccgtggttcaagcgcttc
aacatcggccgcgatcgcatgttcatggaagaaccgccgtacggcctgcgtgacgagcgc
ctgcgcgcgcaggtcagcgccgccatgctgtccggcgacagcgccgccgccggcctgccg
ggcaacccctggcatgccctggccgaaatgcgcgccctgagcaactggacccgccgccac
ctgcaccaggtcaccgccccctgtctggtgatgcacgcccgcgaagacgacgtggccagc
atgggcaacgccgagctggtgatgtcgcgggtcagcggcccgaaggaactggtggtgctg
gaagacagctaccacatgatcaccatcgatcgcgaacggcgcgacgtgatccgtcgcagc
gcgcgcttcttcagcgaaattggtgaacgcagcggcatcctcaaggcggtggcctga

DBGET integrated database retrieval system