KEGG   Stenotrophomonas maltophilia R551-3: Smal_1198Help
Entry
Smal_1198         CDS       T00733                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
smt  Stenotrophomonas maltophilia R551-3
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:smt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smal_1198 (gpmA)
   01230 Biosynthesis of amino acids
    Smal_1198 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smal_1198 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Smal_1198 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Smal_1198 (gpmA)
Enzymes [BR:smt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Smal_1198 (gpmA)
Exosome [BR:smt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Smal_1198 (gpmA)
  Exosomal proteins of melanoma cells
   Smal_1198 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1359405..1360154
Genome map
AA seq 249 aa AA seqDB search
MTRKLVLLRHGQSQWNLDNRFTGWVDVDLTEQGRREAAAAGRLMREEGLQFDVAHTSVLK
RAIHTLQGALAELEQDWLPVNKSWRLNERHYGGLQGLDKAETAAKHGEDQVKVWRRSYDI
PPPAMDLEDPGHPIHDRRYAGLDRNALPGTESLATTLDRVLPYWHDAIAPQLKDGKTVLV
TAHGNSLRALYKYLNNVSREEILELNIPTGIPLLFELNDDLTVKSFRYLGDPEAARKAAE
AVANQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgtaaactcgtactgttgcgccatggccagagccagtggaacctggacaaccgc
ttcaccggctgggtcgatgtcgacctgaccgagcaggggcgccgggaagcggctgccgcc
ggtcgcctgatgcgcgaggaaggcctgcagttcgacgtcgcccacacctccgtgctgaag
cgcgccatccacaccctgcagggtgcgctggccgagctggagcaggactggctgccggtg
aacaagtcctggcgcctcaacgaacgccattacggcggcctgcagggcctggacaaggcc
gagaccgctgccaagcatggcgaggaccaggtcaaggtgtggcgtcgttcgtacgacatc
ccgccgccggccatggacctggaagatccgggccacccgatccatgaccgccgctacgct
ggcctggaccgcaacgcgctgccgggcaccgaatcgctggccaccacgctggaccgcgtg
ctgccgtactggcacgacgccatcgcgccgcagctgaaggacggcaagaccgtgctggtc
accgcccatggcaattcgctgcgcgcactctacaagtacctcaacaacgtctcgcgcgag
gaaatcctcgagctgaacatcccgaccggcattccgctgctgttcgagttgaacgacgac
ctgacggtgaagtcgttccgctacctgggcgacccggaagcggcgcgcaaggccgccgaa
gccgtggccaaccagggcaaggcgaaataa

DBGET integrated database retrieval system